SimulationCraft 1100-02

for World of Warcraft 11.0.7.58911 Live (hotfix 2025-02-03/58911, git build d2465f0)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Combo 1 : 1,466,922 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,466,922.41,466,922.42,908.7 / 0.198%195,226.3 / 13.3%49,052.6
Resource Out In Waiting APM Active
Energy29.929.711.65%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 11,466,922
Auto Attack 0 (70,302)0.0% (4.8%)3.9122.71s5,364,6790

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,9213.2%354.30.99s39,67440,553Direct354.338,39477,33539,67219.4%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.28354.280.000.000.000.97830.000014,055,466.2218,337,731.6623.35%40,552.6540,552.65
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.18%227.3915329938,394.3423,68464,89238,405.2136,49240,5708,729,78711,389,96723.35%
crit19.44%68.873610177,335.3148,521129,97877,384.1969,62985,2435,325,6796,947,76523.35%
miss16.38%58.0235890.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3811.6%353.90.99s19,78820,160Direct353.919,12238,57919,78919.5%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.85353.850.000.000.000.98160.00007,002,111.339,135,334.2823.35%20,160.0020,160.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.21%227.2015629619,121.8111,44332,31319,127.4018,05320,0784,344,0145,667,77123.35%
crit19.47%68.903810538,578.5023,82964,72438,610.4434,66243,3512,658,0973,467,56323.34%
miss16.32%57.7631900.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,2842.1%75.53.68s120,372119,834Direct75.572,975188,837120,35240.9%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.5175.510.000.000.001.00450.00009,089,633.6911,891,846.5223.56%119,833.80119,833.80
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit59.10%44.63256772,974.8157,139141,74572,990.7868,88077,2793,257,0504,263,10323.58%
crit40.90%30.881551188,837.48125,912386,234188,908.60175,646216,8135,832,5837,628,74323.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.51

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,551 (127,780)6.1% (8.7%)13.322.29s2,880,5452,391,628Direct39.8 (78.1)519,5821,049,275674,45029.2% (29.2%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2839.790.000.000.001.20450.000026,821,037.6734,920,349.0523.19%2,391,627.562,391,627.56
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.78%28.161542519,582.25120,1061,931,090519,238.38363,935735,71414,625,83119,043,34323.20%
crit29.22%11.631231,049,275.24240,5733,648,6941,047,509.02391,3942,863,34912,195,20615,877,00623.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.28
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,2282.6%0.00.00s00Direct38.3231,131464,007299,19429.2%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.270.000.000.000.00000.000011,445,003.3711,445,003.370.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.79%27.091441231,130.7657,087837,776231,214.31140,483312,9456,256,6856,256,6850.00%
crit29.21%11.18323464,007.47114,3451,603,861465,237.84175,803761,5765,188,3185,188,3180.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,057)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,0571.4%22.312.57s269,6550Direct22.3269,7660269,7660.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3022.300.000.000.000.00000.00006,014,615.646,014,615.640.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.301141269,765.58260,578318,025269,757.03262,339283,5676,014,6166,014,6160.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 256,684 (367,266)17.5% (25.0%)68.64.35s1,601,8881,594,725Direct68.6 (135.9)858,8821,756,8781,120,17729.1% (29.0%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.6168.610.000.000.001.00450.000076,821,240.1499,930,798.6023.13%1,594,725.151,594,725.15
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.91%48.663068858,882.30210,8622,383,409858,984.36697,3721,040,40341,781,82954,353,63723.13%
crit29.09%19.969361,756,877.82422,3574,709,5731,757,454.261,175,1242,423,60535,039,41145,577,16223.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.62

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,5827.5%67.34.42s491,4880Direct67.3377,322771,251491,61229.0%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.3367.330.000.000.000.00000.000033,090,406.7633,090,406.760.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.99%47.792966377,322.12100,5271,032,853377,351.52319,111457,19218,024,43018,024,4300.00%
crit29.01%19.53735771,251.46201,3562,071,118772,054.33536,1331,067,69415,065,97615,065,9760.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,029 (21,019)0.1% (1.4%)3.791.28s1,697,1781,689,626Direct3.7 (27.6)69,684140,85182,82318.5% (19.4%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000307,616.90307,616.900.00%1,689,626.011,689,626.01
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.50%3.030469,683.9360,925139,36169,460.780102,926210,853210,8530.00%
crit18.50%0.6904140,851.17122,033268,42173,745.940268,42196,76396,7630.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 19,9901.4%0.00.00s00Direct23.9209,623420,479250,85219.5%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.890.000.000.000.00000.00005,992,998.495,992,998.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.46%19.22827209,623.4473,719436,423209,474.16178,295242,8454,029,6954,029,6950.00%
crit19.54%4.67011420,479.43159,472866,985415,365.830690,5861,963,3031,963,3030.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2320.8%0.00.00s00Direct283.810,79821,74812,90819.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.780.000.000.000.00000.00003,662,789.323,662,789.320.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.73%229.0916030910,797.867,51417,53210,799.8210,22611,4772,473,3932,473,3930.00%
crit19.27%54.69339021,747.6715,05135,47921,757.9919,00324,3991,189,3961,189,3960.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 99,013 (117,221)6.8% (8.0%)9.531.31s3,680,4423,664,253Periodic167.2 (334.5)135,815282,737177,37028.3% (28.3%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.540.00167.24167.247.081.00451.741129,658,119.5329,658,119.530.00%116,734.673,664,252.83
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.72%119.9585164135,815.4781430,481135,887.23123,310149,78416,286,92916,286,9290.00%
crit28.28%47.292674282,737.211,369836,047282,945.72224,617359,50613,371,19113,371,1910.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.54
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,2081.2%167.21.76s32,6030Periodic167.225,01551,81332,60028.3%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.240.000.00167.240.000.00000.00005,452,751.125,452,751.120.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.66%119.858015725,014.859,67176,49825,023.1521,58428,0842,997,2152,997,2150.00%
crit28.34%47.39257251,812.7119,371158,10451,904.0340,57364,8132,455,5362,455,5360.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (272,549)0.0% (18.6%)16.018.94s5,097,2995,074,624

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.020.000.000.000.001.00450.00000.000.000.00%5,074,624.095,074,624.09

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.02
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,9224.8%0.00.00s00Direct16.0685,9052,128,9181,308,56043.1%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.020.000.000.000.00000.000020,948,181.4327,306,697.5223.29%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.85%9.11414685,905.41150,6161,638,039686,111.11450,363932,2396,245,9098,165,68023.51%
crit43.15%6.913132,128,918.42301,6844,185,2542,163,199.421,369,9503,280,19414,702,27319,141,01823.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,62713.8%0.00.00s00Direct32.0998,9863,042,9241,900,25044.1%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.960.000.000.000.00000.000060,692,370.9660,692,370.960.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.93%17.88927998,985.65221,6202,368,7991,000,122.37719,1201,298,75417,854,79817,854,7980.00%
crit44.07%14.087233,042,924.06443,9066,052,3753,069,956.922,069,1124,421,48642,837,57342,837,5730.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,884)0.0% (7.2%)3.790.81s8,593,2660

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.660.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.66
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,8847.2%385.71.20s81,5100Periodic385.781,512081,5120.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.670.000.00385.670.000.00000.000031,435,677.2031,435,677.200.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.6729147381,512.12591,068,13281,555.4168,74698,63831,435,67731,435,6770.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3666.35
  • base_dd_max:3666.35
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,6778.0%52.25.83s673,897670,890Direct52.2280,879916,471674,09261.9%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2252.220.000.000.001.00450.000035,188,839.9045,885,086.3423.31%670,889.78670,889.78
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.15%19.921133280,879.43130,261412,242280,848.87252,143309,9475,594,2427,288,65523.25%
crit61.85%32.302244916,470.77287,0431,426,107917,132.30840,045990,37129,594,59838,596,43223.32%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.21

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,6560.2%2.373.22s477,4080Direct2.3401,106802,615477,64519.1%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.292.290.000.000.000.00000.00001,094,861.621,094,861.620.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.93%1.85010401,106.17377,346493,535339,428.520471,163743,900743,9000.00%
crit19.07%0.4403802,615.06755,824966,209280,826.470959,558350,962350,9620.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8300.1%2.266.99s109,9890Direct2.291,428184,178109,84420.0%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.252.250.000.000.000.00000.0000247,453.51247,453.510.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.99%1.800791,427.5583,958117,93376,638.370109,259164,535164,5350.00%
crit20.01%0.4504184,178.05168,168227,66765,618.360222,93482,91982,9190.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:68125.79
  • base_dd_max:68125.79
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,0093.2%18.915.66s743,3000Periodic107.2131,5170131,5170.0%0.0%71.5%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.950.00107.18107.1812.000.00002.000014,084,828.8714,084,828.870.00%65,707.650.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.1863157131,516.8160,995223,326130,471.6473,241177,20014,084,82914,084,8290.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 64,2344.4%32.39.15s595,9780Direct32.3499,159999,546595,89819.4%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.3232.320.000.000.000.00000.000019,261,314.2119,261,314.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.64%26.061252499,158.54453,001861,873498,869.06463,689559,38013,007,97913,007,9790.00%
crit19.36%6.26016999,546.26907,3601,704,893995,169.3001,645,2206,253,3366,253,3360.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4540.3%2.374.17s574,8720Direct2.3480,837963,567574,69719.5%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.322.320.000.000.000.00000.00001,331,132.821,331,132.820.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.52%1.8607480,837.10452,539591,881404,204.930591,881896,418896,4180.00%
crit19.48%0.4503963,567.40906,4361,185,538351,705.6401,107,313434,715434,7150.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,4695.8%58.25.15s439,6670Direct58.2367,962739,044439,62519.3%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.2358.230.000.000.000.00000.000025,601,851.4333,445,875.6123.45%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.65%46.962968367,961.62220,828566,211367,997.98337,798397,60417,276,77822,573,22723.46%
crit19.35%11.27223739,043.60442,3191,145,799740,217.75580,949915,4478,325,07310,872,64923.44%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 1
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.58s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.83s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.411.39s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.440.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.366.30s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.381.55s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.330.0054.740.000.230.00000.83440.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5306.24s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.83.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.780.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.369.53s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.10s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.30
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.266.99s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.252.250.000.000.000.00000.00000.001,543,169.370.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.25090.00000.000001,543,16989.40%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8300.1%2.266.99s109,9890Direct2.291,428184,178109,84420.0%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.252.250.000.000.000.00000.0000247,453.51247,453.510.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.99%1.800791,427.5583,958117,93376,638.370109,259164,535164,5350.00%
crit20.01%0.4504184,178.05168,168227,66765,618.360222,93482,91982,9190.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:68125.79
  • base_dd_max:68125.79
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.36s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.27
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.71s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.467.70s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.390.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1591.3167.0s0.5s279.0s99.95%100.00%581.6 (581.6)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:46.0s / 347.5s
  • trigger_min/max:0.0s / 4.0s
  • trigger_pct:100.00%
  • duration_min/max:2.3s / 360.0s
  • uptime_min/max:99.14% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.15%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.34%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.282.5117.8s3.5s130.6s97.44%0.00%74.4 (77.3)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 341.1s
  • trigger_min/max:1.0s / 39.2s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 358.0s
  • uptime_min/max:86.72% / 99.44%

Stack Uptimes

  • alacrity_1:2.98%
  • alacrity_2:2.17%
  • alacrity_3:1.78%
  • alacrity_4:1.61%
  • alacrity_5:88.90%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.04%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 59.5s
  • trigger_min/max:9.2s / 59.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.34% / 40.75%

Stack Uptimes

  • bolstering_shadows_1:37.04%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.6s90.6s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.0s / 101.1s
  • trigger_min/max:83.0s / 101.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.07%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0132.7s110.8s4.3s1.81%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.0s
  • trigger_min/max:90.0s / 224.9s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 11.9s
  • uptime_min/max:0.00% / 7.04%

Stack Uptimes

  • cryptic_instructions_1:1.81%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.923.1s23.1s8.2s36.46%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 71.6s
  • trigger_min/max:8.0s / 71.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.77% / 39.07%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.55%
  • danse_macabre_4:16.56%
  • danse_macabre_5:8.75%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.774.240.5s3.7s35.3s90.18%95.70%74.2 (74.2)6.7

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 175.4s
  • trigger_min/max:1.0s / 41.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 163.7s
  • uptime_min/max:80.37% / 96.14%

Stack Uptimes

  • deeper_daggers_1:90.18%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.39%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 59.5s
  • trigger_min/max:9.2s / 59.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:14.04% / 22.05%

Stack Uptimes

  • disorienting_strikes_1:12.19%
  • disorienting_strikes_2:6.20%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0131.9s113.3s4.1s1.70%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.6s
  • trigger_min/max:90.0s / 188.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.3s
  • uptime_min/max:0.00% / 6.68%

Stack Uptimes

  • errant_manaforge_emission_1:1.70%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.122.0s5.2s17.3s81.39%0.00%3.2 (3.2)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 60.6s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.6s
  • uptime_min/max:59.77% / 93.44%

Stack Uptimes

  • escalating_blade_1:24.93%
  • escalating_blade_2:21.85%
  • escalating_blade_3:22.62%
  • escalating_blade_4:11.99%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.7s18.21%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:81.6s / 183.3s
  • trigger_min/max:81.6s / 183.3s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 15.0s
  • uptime_min/max:13.74% / 20.85%

Stack Uptimes

  • ethereal_powerlink_1:18.21%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.281.2s68.5s15.5s11.08%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4576.07

Trigger Details

  • interval_min/max:15.0s / 331.0s
  • trigger_min/max:1.0s / 331.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 48.5s
  • uptime_min/max:0.00% / 42.45%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:11.08%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.9s14.68%0.00%14.4 (96.4)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.3s
  • trigger_min/max:1.0s / 91.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.82% / 16.94%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.76%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.57%
  • flagellation_buff_11:0.46%
  • flagellation_buff_12:0.01%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.44%
  • flagellation_buff_20:0.38%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.87%
  • flagellation_buff_26:0.37%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.13%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.27%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.1s / 98.3s
  • trigger_min/max:78.1s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.44% / 16.24%

Stack Uptimes

  • flagellation_persist_1:0.01%
  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.26%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6112.6s76.4s35.1s24.99%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:32.3s / 335.2s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 204.1s
  • uptime_min/max:0.00% / 78.64%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.99%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6110.0s76.4s35.0s24.40%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.6s / 345.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 177.9s
  • uptime_min/max:0.00% / 73.59%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.40%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.20.6110.9s76.7s35.5s25.48%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 330.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 210.0s
  • uptime_min/max:0.00% / 67.90%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.48%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.7112.1s76.3s35.9s25.13%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 346.8s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.0s
  • uptime_min/max:0.00% / 86.05%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.13%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.50.039.6s3.4s59.3s95.36%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.57%
  • flawless_form_2:8.69%
  • flawless_form_3:11.78%
  • flawless_form_4:9.72%
  • flawless_form_5:2.82%
  • flawless_form_6:4.48%
  • flawless_form_7:5.87%
  • flawless_form_8:11.24%
  • flawless_form_9:18.35%
  • flawless_form_10:8.97%
  • flawless_form_11:1.51%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.17%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.287.1s72.9s17.0s10.92%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:4.9s / 285.1s
  • trigger_min/max:0.3s / 285.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 61.4s
  • uptime_min/max:0.00% / 39.77%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.92%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.9s74.3s17.0s10.77%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.8s / 316.7s
  • trigger_min/max:0.1s / 316.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 54.4s
  • uptime_min/max:0.00% / 47.04%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.78%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.285.2s70.8s17.1s10.84%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.0s / 298.7s
  • trigger_min/max:0.2s / 298.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 54.5s
  • uptime_min/max:0.00% / 42.70%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.84%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.287.5s73.6s16.9s10.64%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.2s / 317.1s
  • trigger_min/max:0.2s / 298.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.4s
  • uptime_min/max:0.00% / 39.51%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.64%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.6s16.92%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.7s
  • trigger_min/max:1.0s / 65.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.9s
  • uptime_min/max:9.49% / 26.95%

Stack Uptimes

  • poised_shadows_1:16.92%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.63%11.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 63.8s
  • trigger_min/max:1.0s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.4s
  • uptime_min/max:0.98% / 4.68%

Stack Uptimes

  • premeditation_1:2.63%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0126.7s111.2s3.9s1.59%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.8s
  • trigger_min/max:90.0s / 189.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 10.2s
  • uptime_min/max:0.00% / 7.84%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.59%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.282.5s69.7s15.4s10.85%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23996.43

Trigger Details

  • interval_min/max:15.0s / 292.1s
  • trigger_min/max:0.3s / 292.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 47.4s
  • uptime_min/max:0.00% / 38.04%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.85%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.70.090.8s90.8s15.8s19.25%17.19%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.7s
  • trigger_min/max:90.0s / 97.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.70% / 21.91%

Stack Uptimes

  • shadow_blades_1:19.25%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.46%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 71.6s
  • trigger_min/max:8.0s / 71.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.77% / 39.07%

Stack Uptimes

  • shadow_dance_1:36.46%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.1138.54.4s1.4s3.5s79.15%95.49%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 44.4s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.2s
  • uptime_min/max:72.05% / 86.51%

Stack Uptimes

  • shadow_techniques_1:20.55%
  • shadow_techniques_2:20.94%
  • shadow_techniques_3:9.48%
  • shadow_techniques_4:10.46%
  • shadow_techniques_5:6.07%
  • shadow_techniques_6:5.78%
  • shadow_techniques_7:2.58%
  • shadow_techniques_8:2.27%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.8s99.32%87.40%98.8 (98.8)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 358.0s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.50.0107.6s95.8s9.9s1.78%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:5.0s / 301.6s
  • trigger_min/max:0.3s / 292.0s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 18.6s
  • uptime_min/max:0.00% / 12.36%

Stack Uptimes

  • storm_sewers_citrine_1:1.78%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0102.5s95.4s9.9s1.84%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:5.0s / 300.6s
  • trigger_min/max:1.0s / 300.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s
  • uptime_min/max:0.00% / 15.23%

Stack Uptimes

  • storm_sewers_citrine_1:1.84%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.099.3s93.0s9.9s1.94%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:7.0s / 302.2s
  • trigger_min/max:1.0s / 302.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:0.00% / 17.40%

Stack Uptimes

  • storm_sewers_citrine_1:1.94%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.280.7s69.2s15.4s10.57%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1423.70
  • stat:haste_rating
  • amount:1423.70
  • stat:mastery_rating
  • amount:1423.70
  • stat:versatility_rating
  • amount:1423.70

Trigger Details

  • interval_min/max:15.3s / 318.0s
  • trigger_min/max:0.3s / 318.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.5s
  • uptime_min/max:0.00% / 36.06%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.57%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.3s21.3s2.3s10.98%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 65.6s
  • trigger_min/max:3.0s / 65.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.5s
  • uptime_min/max:8.98% / 14.23%

Stack Uptimes

  • supercharge_1_1:10.98%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.03%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.6s
  • trigger_min/max:1.0s / 65.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.5s
  • uptime_min/max:0.30% / 4.97%

Stack Uptimes

  • supercharge_2_1:2.03%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.6s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 2.0s
  • uptime_min/max:0.00% / 0.71%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.944.0s21.3s24.8s61.14%100.00%6.9 (6.9)6.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 96.9s
  • trigger_min/max:1.0s / 65.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:55.30% / 65.42%

Stack Uptimes

  • symbols_of_death_1:61.14%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.2s307.2s27.2s13.33%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.8s
  • trigger_min/max:300.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.95% / 18.10%

Stack Uptimes

  • tempered_potion_1:13.33%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.3s21.3s2.9s13.79%22.25%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 65.6s
  • trigger_min/max:1.0s / 65.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.2s
  • uptime_min/max:11.34% / 16.85%

Stack Uptimes

  • the_rotten_1:10.73%
  • the_rotten_2:3.06%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 135.8s
  • trigger_min/max:120.0s / 135.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.39%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.079.8s42.4s14.9s0.58%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4606.66

Trigger Details

  • interval_min/max:16.5s / 158.5s
  • trigger_min/max:0.3s / 158.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 24.8s
  • uptime_min/max:0.00% / 10.78%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.63%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.10.285.8s72.8s15.5s10.57%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5915.46

Trigger Details

  • interval_min/max:15.1s / 330.6s
  • trigger_min/max:1.0s / 330.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.3s
  • uptime_min/max:0.00% / 34.96%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.57%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.426.075.06.0s0.7s61.2s
Skyfury (Off Hand)49.526.079.06.0s0.7s59.3s
Supercharger secret_technique12.58.016.023.6s9.2s92.9s
Cold Blood secret_technique3.63.04.090.6s83.0s101.1s
Supercharger rupture0.20.02.0180.3s62.6s285.0s
Supercharger coup_de_grace2.80.08.074.8s9.2s324.0s
Supercharger eviscerate12.96.021.023.2s1.0s153.9s
CP Spent During Flagellation202.5112.0254.011.2s1.0s172.4s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.35%6.01%13.51%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 1
Energy RegenEnergy1,435.843,036.3734.12%2.11396.1511.54%
Improved AmbushCombo Points52.2133.414.56%0.6418.7936.00%
PremeditationCombo Points17.2156.907.77%3.3163.5552.76%
Relentless StrikesEnergy107.464,273.4548.02%39.77125.442.85%
Shadow BladesCombo Points21.97114.1315.59%5.1917.7213.44%
Shadow TechniquesEnergy359.681,234.0513.87%3.43204.6814.23%
Shadow TechniquesCombo Points85.73241.0532.93%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.28106.9914.62%7.000.000.00%
BackstabCombo Points75.5175.1910.27%1.000.320.42%
ShadowstrikeCombo Points52.21104.3814.26%2.000.030.03%
Symbols of DeathEnergy14.26356.254.00%24.98214.3237.56%
Usage Type Count Total Tot% Avg RPE APR
Combo 1
BackstabEnergy75.513,020.4433.73%40.0040.003,009.37
Coup de GraceEnergy13.28464.915.19%35.0035.0082,308.40
Coup de GraceCombo Points13.2890.7112.46%6.836.83421,848.75
EviscerateEnergy68.622,401.5926.82%35.0035.0045,766.26
EviscerateCombo Points68.62467.3764.19%6.816.81235,172.87
RuptureEnergy9.54238.512.66%25.0025.00147,211.12
RuptureCombo Points9.5465.278.96%6.846.84537,911.49
Secret TechniqueEnergy16.02480.515.37%30.0030.00169,903.04
Secret TechniqueCombo Points16.02104.7614.39%6.546.54779,274.28
ShadowstrikeEnergy52.212,349.2326.23%45.0044.9914,978.90
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6929.87940.245.00.2100.0
Combo Points0.02.442.43100.43.90.07.0

Statistics & Data Analysis

Fight Length
Combo 1 Fight Length
Count 1217
Mean 299.79
Minimum 240.00
Maximum 359.97
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Combo 1 Damage Per Second
Count 1217
Mean 1466922.44
Minimum 1282773.24
Maximum 1629541.13
Spread ( max - min ) 346767.88
Range [ ( max - min ) / 2 * 100% ] 11.82%
Standard Deviation 51771.4438
5th Percentile 1381905.04
95th Percentile 1551057.49
( 95th Percentile - 5th Percentile ) 169152.45
Mean Distribution
Standard Deviation 1484.0379
95.00% Confidence Interval ( 1464013.78 - 1469831.10 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4785
0.1 Scale Factor Error with Delta=300 22880433
0.05 Scale Factor Error with Delta=300 91521729
0.01 Scale Factor Error with Delta=300 2288043212
Priority Target DPS
Combo 1 Priority Target Damage Per Second
Count 1217
Mean 1466922.44
Minimum 1282773.24
Maximum 1629541.13
Spread ( max - min ) 346767.88
Range [ ( max - min ) / 2 * 100% ] 11.82%
Standard Deviation 51771.4438
5th Percentile 1381905.04
95th Percentile 1551057.49
( 95th Percentile - 5th Percentile ) 169152.45
Mean Distribution
Standard Deviation 1484.0379
95.00% Confidence Interval ( 1464013.78 - 1469831.10 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4785
0.1 Scale Factor Error with Delta=300 22880433
0.05 Scale Factor Error with Delta=300 91521729
0.01 Scale Factor Error with Delta=300 2288043212
DPS(e)
Combo 1 Damage Per Second (Effective)
Count 1217
Mean 1466922.44
Minimum 1282773.24
Maximum 1629541.13
Spread ( max - min ) 346767.88
Range [ ( max - min ) / 2 * 100% ] 11.82%
Damage
Combo 1 Damage
Count 1217
Mean 439300302.12
Minimum 337226091.34
Maximum 540732989.63
Spread ( max - min ) 203506898.29
Range [ ( max - min ) / 2 * 100% ] 23.16%
DTPS
Combo 1 Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 1 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 1 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 1 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 1 Healing Taken Per Second
Count 1217
Mean 3114.98
Minimum 0.00
Maximum 11364.55
Spread ( max - min ) 11364.55
Range [ ( max - min ) / 2 * 100% ] 182.42%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.21 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.51 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.27 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.66 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.02 secret_technique,if=variable.secret
L 9.54 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.28 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.62 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.30 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNDNHNDMQFKDNDNNDNENEEHQNDKDMDNDLEENEENHQDKDNDMDNEENEHNEKEELEMEENEENENEENEENEEOLEEJHQPKDINDNNDMENHQNDFKNDNDNENELEENEREMEEHQKDNDNDNDNENEENEEKEEELEEEEMENEEELEOEEJHQPKDIMDNNDNNHQDNDFKNDNNENEMHQDNDKDNDNELEENENEEHQMDKDNDNDNENEENRDNEKQEHM

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, cryptic_instructions
0:01.005Gpotion
[cds]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, cryptic_instructions
0:01.005Jflagellation
[cds]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, cryptic_instructions, tempered_potion
0:02.009Neviscerate
[finish]
Fluffy_Pillow 86.4/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, cryptic_instructions, tempered_potion
0:03.013Rvanish
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:03.013Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), alacrity, flawless_form, premeditation, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:05.021Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, tempered_potion
0:05.021Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, tempered_potion
0:05.021Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, tempered_potion
0:05.021Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:06.023Ishadow_blades
[cds]
Combo 1 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:06.023Ksecret_technique
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:07.026Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:08.030Neviscerate
[finish]
Fluffy_Pillow 85.9/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:09.034Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:10.037Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:11.043Neviscerate
[finish]
Fluffy_Pillow 78.2/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:12.048Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:13.052Neviscerate
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(10), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.057Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.057Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:15.060Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.065Mcoup_de_grace
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(4), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.270Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.270Fcold_blood
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.270Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(9), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.274Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:19.279Neviscerate
[finish]
Fluffy_Pillow 70.3/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.285Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.291Neviscerate
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.295Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.298Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:24.304Neviscerate
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.309Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.312Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.317Ebackstab
[build]
Fluffy_Pillow 92.2/100 92% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.320Ebackstab
[build]
Fluffy_Pillow 66.7/100 67% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.326Hsymbols_of_death
[cds]
Combo 1 57.3/100 57% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.326Qshadow_dance
[stealth_cds]
Combo 1 97.3/100 97% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.326Neviscerate
[finish]
Fluffy_Pillow 97.3/100 97% energy
4.0/7 57% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.331Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.336Ksecret_technique
[finish]
Fluffy_Pillow 69.4/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:32.344Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:33.349Mcoup_de_grace
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:34.553Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:35.558Neviscerate
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:36.563Dshadowstrike
[build]
Fluffy_Pillow 99.1/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:37.567Lrupture
[finish]
Fluffy_Pillow 68.1/100 68% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:38.571Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:39.575Ebackstab
[build]
Fluffy_Pillow 90.3/100 90% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:40.578Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:41.584Ebackstab
[build]
Fluffy_Pillow 81.8/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:42.590Ebackstab
[build]
Fluffy_Pillow 60.9/100 61% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:43.596Neviscerate
[finish]
Fluffy_Pillow 39.9/100 40% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:44.601Hsymbols_of_death
[cds]
Combo 1 59.0/100 59% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:44.601Qshadow_dance
[stealth_cds]
Combo 1 99.0/100 99% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:44.601Dshadowstrike
[build]
Fluffy_Pillow 99.0/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:45.606Ksecret_technique
[finish]
Fluffy_Pillow 73.0/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:46.612Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:47.615Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:48.619Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:49.621Mcoup_de_grace
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:50.826Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:51.831Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:52.834Ebackstab
[build]
Fluffy_Pillow 93.1/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:53.840Ebackstab
[build]
Fluffy_Pillow 64.0/100 64% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
0:54.844Neviscerate
[finish]
Fluffy_Pillow 42.8/100 43% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:55.850Ebackstab
[build]
Fluffy_Pillow 48.6/100 49% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:56.855Hsymbols_of_death
[cds]
Combo 1 27.4/100 27% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:56.855Neviscerate
[finish]
Fluffy_Pillow 67.4/100 67% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:57.860Ebackstab
[build]
Fluffy_Pillow 81.2/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:58.865Ksecret_technique
[finish]
Fluffy_Pillow 52.0/100 52% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:59.873Ebackstab
[build]
Fluffy_Pillow 80.9/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:00.879Ebackstab
[build]
Fluffy_Pillow 59.7/100 60% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:01.882Lrupture
[finish]
Fluffy_Pillow 38.5/100 38% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:02.887Ebackstab
[build]
Fluffy_Pillow 70.3/100 70% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:03.891Mcoup_de_grace
[finish]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:05.096Ebackstab
[build]
Fluffy_Pillow 87.0/100 87% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(11), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:06.100Ebackstab
[build]
Fluffy_Pillow 65.8/100 66% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
1:07.106Neviscerate
[finish]
Fluffy_Pillow 44.6/100 45% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
1:08.110Ebackstab
[build]
Fluffy_Pillow 58.8/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
1:09.366Ebackstab
[build]
Fluffy_Pillow 49.1/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
1:11.043Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
1:12.047Ebackstab
[build]
Fluffy_Pillow 55.5/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_haste
1:13.460Neviscerate
[finish]
Fluffy_Pillow 35.6/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:14.465Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
1:16.807Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:19.147Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:20.153Ebackstab
[build]
Fluffy_Pillow 42.6/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:22.778Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:25.235Neviscerate
[finish]
Fluffy_Pillow 40.3/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
1:26.240Ebackstab
[build]
Fluffy_Pillow 46.7/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
1:28.959Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:29.964Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 17.0/100 17% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:30.685Lrupture
[finish]
Fluffy_Pillow 25.2/100 25% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:31.691Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:34.144Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:35.149Jflagellation
[cds]
Fluffy_Pillow 12.9/100 13% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:36.153Hsymbols_of_death
[cds]
Combo 1 28.3/100 28% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, flagellation_buff, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:36.153Qshadow_dance
[stealth_cds]
Combo 1 68.3/100 68% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:36.153Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.3/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:36.153Ksecret_technique
[finish]
Fluffy_Pillow 68.3/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:37.158Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:38.163Ishadow_blades
[cds]
Combo 1 66.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:38.163Neviscerate
[finish]
Fluffy_Pillow 66.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:39.168Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:40.173Neviscerate
[finish]
Fluffy_Pillow 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(9), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:41.177Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:42.182Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:43.188Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:44.393Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:45.398Neviscerate
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:46.401Hsymbols_of_death
[cds]
Combo 1 90.7/100 91% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:46.401Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:46.401Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:47.406Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:48.411Fcold_blood
[cds]
Combo 1 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:48.411Ksecret_technique
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:49.415Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:50.419Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:51.424Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:52.429Dshadowstrike
[build]
Fluffy_Pillow 93.7/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:53.435Neviscerate
[finish]
Fluffy_Pillow 60.0/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:54.438Ebackstab
[build]
Fluffy_Pillow 79.4/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:55.444Neviscerate
[finish]
Fluffy_Pillow 58.7/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:56.449Ebackstab
[build]
Fluffy_Pillow 77.9/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:57.453Lrupture
[finish]
Fluffy_Pillow 48.7/100 49% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:58.458Ebackstab
[build]
Fluffy_Pillow 77.5/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:59.462Ebackstab
[build]
Fluffy_Pillow 64.3/100 64% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
2:00.466Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
2:01.471Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
2:04.318Rvanish
[stealth_cds]
Combo 1 40.5/100 40% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
2:04.318Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
2.0/7 29% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, premeditation, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
2:07.268Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
2:08.473Ebackstab
[build]
Fluffy_Pillow 78.8/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
2:09.477Ebackstab
[build]
Fluffy_Pillow 50.2/100 50% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), deeper_daggers, flask_of_alchemical_chaos_haste
2:10.480Hsymbols_of_death
[cds]
Combo 1 25.6/100 26% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:10.480Qshadow_dance
[stealth_cds]
Combo 1 65.6/100 66% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:10.480Ksecret_technique
[finish]
Fluffy_Pillow 65.6/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:11.484Dshadowstrike
[build]
Fluffy_Pillow 95.0/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(7), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
2:12.488Neviscerate
[finish]
Fluffy_Pillow 69.4/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:13.493Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(9), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:14.497Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:15.502Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:16.507Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:17.512Dshadowstrike
[build]
Fluffy_Pillow 79.6/100 80% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_haste
2:18.516Neviscerate
[finish]
Fluffy_Pillow 46.0/100 46% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
2:19.521Ebackstab
[build]
Fluffy_Pillow 65.5/100 65% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
2:20.526Neviscerate
[finish]
Fluffy_Pillow 44.9/100 45% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:21.530Ebackstab
[build]
Fluffy_Pillow 59.3/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
2:22.681Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:24.855Neviscerate
[finish]
Fluffy_Pillow 37.0/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
2:25.857Ebackstab
[build]
Fluffy_Pillow 48.4/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(4), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:28.317Ebackstab
[build]
Fluffy_Pillow 44.3/100 44% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:30.244Ksecret_technique
[finish]
Fluffy_Pillow 30.2/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:31.247Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:33.837Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:36.718Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:38.653Lrupture
[finish]
Fluffy_Pillow 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:39.656Ebackstab
[build]
Fluffy_Pillow 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:42.338Ebackstab
[build]
Fluffy_Pillow 44.9/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:45.315Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:48.359Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), shadow_techniques(3), stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:51.326Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques(4), stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:52.530Ebackstab
[build]
Fluffy_Pillow 77.9/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques(5), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:53.533Neviscerate
[finish]
Fluffy_Pillow 48.3/100 48% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form(7), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:54.537Ebackstab
[build]
Fluffy_Pillow 57.8/100 58% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:56.402Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Mastery, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:59.419Ebackstab
[build]
Fluffy_Pillow 44.7/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Mastery, flask_of_alchemical_chaos_mastery
3:01.453Lrupture
[finish]
Fluffy_Pillow 26.0/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Mastery, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:02.456Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(6), shadow_techniques, windsingers_runed_citrine_Mastery, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:03.462Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 21.1/100 21% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(2), shadow_techniques, windsingers_runed_citrine_Mastery, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:05.354Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form, shadow_techniques, windsingers_runed_citrine_Mastery, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:08.377Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(2), shadow_techniques(2), windsingers_runed_citrine_Mastery, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:09.382Jflagellation
[cds]
Fluffy_Pillow 15.5/100 16% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(4), flawless_form(3), shadow_techniques, windsingers_runed_citrine_Mastery, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:10.387Hsymbols_of_death
[cds]
Combo 1 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(4), flawless_form(3), shadow_techniques, flagellation_buff, stormbringers_runed_citrine_proc, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:10.387Qshadow_dance
[stealth_cds]
Combo 1 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:10.387Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:10.387Ksecret_technique
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:11.393Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(11), poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:12.397Ishadow_blades
[cds]
Combo 1 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(5), the_rotten, flagellation_buff(11), bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:12.397Mcoup_de_grace
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(5), the_rotten, flagellation_buff(11), bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:13.603Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(10), shadow_techniques(7), the_rotten, flagellation_buff(26), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:14.609Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(9), flagellation_buff(26), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:15.614Neviscerate
[finish]
Fluffy_Pillow 93.1/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:16.619Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:17.625Neviscerate
[finish]
Fluffy_Pillow 82.1/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:18.629Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:19.634Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:19.634Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:19.634Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:20.640Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:21.641Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:22.643Fcold_blood
[cds]
Combo 1 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(9), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:22.643Ksecret_technique
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(9), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:23.648Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:24.652Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:25.656Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
3:26.660Neviscerate
[finish]
Fluffy_Pillow 93.1/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
3:27.664Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
3:28.667Neviscerate
[finish]
Fluffy_Pillow 79.0/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
3:29.673Ebackstab
[build]
Fluffy_Pillow 90.1/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
3:30.678Mcoup_de_grace
[finish]
Fluffy_Pillow 69.1/100 69% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
3:31.883Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:31.883Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:31.883Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:32.887Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:33.892Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:34.895Ksecret_technique
[finish]
Fluffy_Pillow 81.4/100 81% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:35.900Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:36.904Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:37.910Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:38.913Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:39.917Ebackstab
[build]
Fluffy_Pillow 85.2/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:40.923Lrupture
[finish]
Fluffy_Pillow 64.0/100 64% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:41.927Ebackstab
[build]
Fluffy_Pillow 92.8/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:42.930Ebackstab
[build]
Fluffy_Pillow 63.5/100 64% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:43.934Neviscerate
[finish]
Fluffy_Pillow 42.3/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:44.939Ebackstab
[build]
Fluffy_Pillow 64.1/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
3:45.942Neviscerate
[finish]
Fluffy_Pillow 42.9/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:46.947Ebackstab
[build]
Fluffy_Pillow 61.7/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:48.295Ebackstab
[build]
Fluffy_Pillow 44.2/100 44% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:50.034Hsymbols_of_death
[cds]
Combo 1 22.9/100 23% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:50.034Qshadow_dance
[stealth_cds]
Combo 1 62.9/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:50.034Mcoup_de_grace
[finish]
Fluffy_Pillow 62.9/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:51.237Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:52.241Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:53.246Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:54.250Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:55.254Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:56.259Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:57.263Dshadowstrike
[build]
Fluffy_Pillow 77.2/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(5), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:58.269Neviscerate
[finish]
Fluffy_Pillow 43.0/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques, deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
3:59.273Ebackstab
[build]
Fluffy_Pillow 69.8/100 70% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
4:00.279Neviscerate
[finish]
Fluffy_Pillow 40.6/100 41% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
4:01.284Ebackstab
[build]
Fluffy_Pillow 54.4/100 54% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
4:03.004Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
4:05.867Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:06.872Rvanish
[stealth_cds]
Combo 1 46.3/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:06.872Dshadowstrike
[build]
Fluffy_Pillow 46.3/100 46% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:09.279Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:10.285Ebackstab
[build]
Fluffy_Pillow 50.7/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(5), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:11.732Ksecret_technique
[finish]
Fluffy_Pillow 30.6/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:12.735Qshadow_dance
[stealth_cds]
Combo 1 41.6/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:12.735Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:15.071Hsymbols_of_death
[cds]
Combo 1 31.3/100 31% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:15.071Mcoup_de_grace
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.35%2.79%1843
Versatility29.74%22.21%17321
Attack Power6162857457938
Mastery66.00%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 1"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 2 : 1,450,763 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,450,763.11,450,763.12,785.1 / 0.192%187,079.9 / 12.9%48,501.5
Resource Out In Waiting APM Active
Energy29.929.711.65%57.2100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 21,450,763
Auto Attack 0 (71,860)0.0% (5.0%)3.9122.45s5,498,8800

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 48,0123.3%354.60.98s40,56441,491Direct354.638,12576,76540,56522.4%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.58354.580.000.000.000.97770.000014,383,025.6918,754,120.3323.31%41,490.6541,490.65
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.25%217.1815428638,125.1722,57064,49638,138.1536,17740,3258,280,33510,797,72923.31%
crit22.42%79.494712676,765.0046,792129,13776,830.4070,78785,7596,102,6917,956,39123.30%
miss16.33%57.9035860.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,8481.6%353.90.98s20,18420,578Direct353.918,97338,30920,18422.4%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.87353.870.000.000.000.98090.00007,142,581.789,313,605.4123.31%20,577.8820,577.88
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.24%216.7215029518,972.6011,34132,11618,981.6117,89120,1094,111,6205,361,83223.32%
crit22.36%79.124911938,309.4922,49264,30538,328.2235,09742,8513,030,9613,951,77323.30%
miss16.40%58.0334880.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,7832.1%75.43.68s122,558122,009Direct75.472,431186,789122,55343.8%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.4275.420.000.000.001.00450.00009,243,379.5712,081,596.0223.49%122,008.71122,008.71
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.17%42.37236472,430.7856,630157,96972,431.6868,35477,0083,068,3454,012,91123.53%
crit43.83%33.051756186,788.62124,790382,801186,902.13171,492212,7856,175,0348,068,68523.48%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.42

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 87,910 (125,735)6.1% (8.7%)13.322.48s2,824,5122,345,031Direct39.9 (78.5)499,490996,657659,38332.2% (32.4%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3239.910.000.000.001.20450.000026,315,350.5234,253,926.8023.18%2,345,030.792,345,030.79
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.84%27.081443499,490.40112,5361,813,189499,972.81320,631717,93813,517,68317,596,48323.18%
crit32.16%12.84324996,657.21227,6373,655,598997,261.57493,6901,638,12212,797,66816,657,44423.18%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.32
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 37,8252.6%0.00.00s00Direct38.6220,604443,027293,25532.7%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.610.000.000.000.00000.000011,320,048.6411,320,048.640.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.32%26.001341220,603.7754,181786,626220,909.64139,308316,8565,733,3125,733,3120.00%
crit32.68%12.62423443,027.16108,5241,585,929443,251.06216,015711,2815,586,7375,586,7370.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (19,959)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 19,9591.4%22.412.81s267,4340Direct22.4267,5330267,5330.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3622.350.000.000.000.00000.00005,980,009.755,980,009.750.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.351236267,533.30258,255312,868267,505.60260,702276,8245,980,0105,980,0100.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 251,969 (360,469)17.4% (24.8%)68.64.38s1,572,2881,565,247Direct68.6 (136.2)822,1241,682,7931,099,02832.2% (32.1%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.6368.630.000.000.001.00450.000075,419,623.7098,097,707.5323.12%1,565,247.281,565,247.28
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.82%46.542964822,123.95200,1282,390,303821,569.16671,646979,27238,246,59449,749,87923.12%
crit32.18%22.0810371,682,793.42400,8574,879,1221,683,291.751,207,5222,255,16037,173,02948,347,82923.11%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.64

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 108,5007.5%67.54.46s480,9060Direct67.5360,864735,656480,94632.0%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.5467.540.000.000.000.00000.000032,479,132.2032,479,132.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.96%45.902965360,863.5795,4101,056,783360,767.92298,371431,83616,557,73916,557,7390.00%
crit32.04%21.64937735,655.96191,1062,045,694736,235.42507,583975,13515,921,39315,921,3930.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,046 (21,366)0.1% (1.5%)3.791.42s1,724,4541,717,161Direct3.7 (27.6)69,113138,56984,16921.8% (22.5%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000312,820.54312,820.540.00%1,717,161.111,717,161.11
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit78.25%2.910469,113.2360,382138,26268,568.52099,631200,867200,8670.00%
crit21.75%0.8104138,569.03120,945262,47081,174.280262,093111,953111,9530.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,3201.4%0.00.00s00Direct23.9208,312413,853254,73722.6%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.910.000.000.000.00000.00006,090,473.246,090,473.240.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.42%18.51727208,312.2976,715447,108208,193.69165,371249,9043,856,3593,856,3590.00%
crit22.58%5.40014413,852.53153,660881,857412,494.240765,9662,234,1142,234,1140.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,4170.9%0.00.00s00Direct282.910,70921,53613,15122.6%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00282.890.000.000.000.00000.00003,720,334.003,720,334.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.45%219.0914929210,709.087,44717,60510,713.0910,09911,2942,346,2372,346,2370.00%
crit22.55%63.80369821,535.7314,91735,24921,550.5919,51424,0781,374,0971,374,0970.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 96,919 (114,757)6.7% (7.9%)9.531.26s3,610,2763,594,158Periodic167.3 (334.5)129,923268,690173,54131.4% (31.4%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.520.00167.27167.277.051.00451.740129,024,879.8629,024,879.860.00%114,317.343,594,157.80
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit68.57%114.6979152129,922.55116436,005129,980.30114,423146,34814,899,10914,899,1090.00%
crit31.43%52.583083268,690.33178844,887269,054.66209,277340,92214,125,77114,125,7710.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.52
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 17,8381.2%167.31.76s31,9390Periodic167.323,87149,54731,94031.4%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.270.000.00167.270.000.00000.00005,342,457.065,342,457.060.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit68.56%114.698215123,870.859,17979,94623,884.7321,12327,0252,737,3222,737,3220.00%
crit31.44%52.58308349,547.2518,385154,91949,607.8540,09563,3222,605,1352,605,1350.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (264,312)0.0% (18.2%)16.018.95s4,937,3674,915,306

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.030.000.000.000.001.00450.00000.000.000.00%4,915,306.084,915,306.08

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.03
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 67,7244.7%0.00.00s00Direct16.0654,3592,008,4411,264,52845.1%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.030.000.000.000.00000.000020,275,741.7126,420,734.5323.26%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit54.93%8.81315654,359.14143,3861,598,545655,067.81395,969931,0315,761,3477,523,93823.43%
crit45.07%7.233142,008,441.24297,2754,182,1042,046,722.731,326,0433,247,88414,514,39418,896,79723.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 196,58813.6%0.00.00s00Direct32.0949,1972,868,0891,842,18246.5%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.960.000.000.000.00000.000058,880,347.3958,880,347.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.49%17.10926949,197.30210,3392,311,685950,309.59617,1311,324,28016,225,86516,225,8650.00%
crit46.51%14.878242,868,089.13422,5976,047,8202,893,625.041,902,0744,182,90542,654,48342,654,4830.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (103,889)0.0% (7.2%)3.791.01s8,507,4020

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.660.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.66
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 103,8897.2%385.71.21s80,6880Periodic385.780,677080,6770.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.700.000.00385.700.000.00000.000031,121,570.8031,121,570.800.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.7028747080,677.01261,106,58480,753.4868,63693,16231,121,57131,121,5710.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4311.57
  • base_dd_max:4311.57
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 118,1468.1%52.35.81s675,655672,642Direct52.3278,484903,708675,70963.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.3052.300.000.000.001.00450.000035,337,231.6746,062,790.9123.28%672,641.70672,641.70
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit36.46%19.071130278,484.40129,100419,061278,549.10240,120309,0335,310,1186,917,98823.24%
crit63.54%33.232245903,707.70284,4851,416,877904,597.59834,392983,85730,027,11439,144,80323.29%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.29

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,6160.2%2.376.45s477,6390Direct2.3389,919778,444478,02422.7%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.272.270.000.000.000.00000.00001,084,401.281,084,401.280.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.33%1.7508389,919.48366,167476,698317,463.770457,563684,004684,0040.00%
crit22.67%0.5104778,444.32733,432931,525313,178.680931,525400,397400,3970.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8440.1%2.375.85s107,8450Direct2.388,265176,497107,90922.2%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.0000252,731.08252,731.080.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.81%1.820888,264.7580,745116,90373,460.180116,903160,916160,9160.00%
crit22.19%0.5205176,496.75161,733230,56770,022.000221,13691,81591,8150.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:68261.28
  • base_dd_max:68261.28
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 46,6853.2%19.015.06s737,3350Periodic107.4130,4230130,4230.0%0.0%71.7%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.010.00107.45107.4512.020.00002.000014,015,415.2614,015,415.260.00%65,220.130.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.4563156130,422.6860,451219,718129,425.1864,550173,45214,015,41514,015,4150.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 64,3004.4%32.59.10s593,5580Direct32.5485,141973,787593,70322.2%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.4632.460.000.000.000.00000.000019,265,032.8419,265,032.840.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.81%25.251145485,141.35439,580848,812484,842.16453,846534,30412,250,42112,250,4210.00%
crit22.19%7.20021973,787.18880,4791,657,335970,709.5801,228,4037,014,6127,014,6120.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,6270.3%2.473.66s574,6710Direct2.4467,400937,619574,85222.8%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.412.410.000.000.000.00000.00001,387,805.261,387,805.260.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.17%1.8607467,400.39439,132561,299399,134.290546,153870,960870,9600.00%
crit22.83%0.5504937,618.68879,5821,124,281396,862.6601,124,281516,845516,8450.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 86,9996.0%58.25.20s447,4260Direct58.2364,791734,755447,34922.3%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.2558.250.000.000.000.00000.000026,060,634.1334,025,195.3423.41%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.66%45.242964364,791.47218,860568,339364,976.07334,050398,85016,500,53921,546,38523.42%
crit22.34%13.01429734,754.85438,3761,109,309736,048.27565,774902,0409,560,09512,478,81023.39%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 2
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.83s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.46s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.711.61s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.700.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.373.68s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.373.08s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.290.0053.970.000.230.00000.83450.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5306.27s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.83.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.770.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.371.07s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.320.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.14s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.31
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.375.85s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.342.340.000.000.000.00000.00000.001,561,647.080.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.340100.00000.000001,561,64790.39%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8440.1%2.375.85s107,8450Direct2.388,265176,497107,90922.2%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.0000252,731.08252,731.080.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.81%1.820888,264.7580,745116,90373,460.180116,903160,916160,9160.00%
crit22.19%0.5205176,496.75161,733230,56770,022.000221,13691,81591,8150.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:68261.28
  • base_dd_max:68261.28
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.36s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.27
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.45s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.92
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.472.63s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.400.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1591.4164.2s0.5s274.2s99.95%100.00%581.6 (581.6)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:4.7s / 335.3s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 360.0s
  • uptime_min/max:99.10% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.24%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.16%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.31%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.5116.2s3.5s125.2s97.37%0.00%74.0 (76.8)1.3

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 353.4s
  • trigger_min/max:1.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 357.5s
  • uptime_min/max:86.73% / 99.44%

Stack Uptimes

  • alacrity_1:3.07%
  • alacrity_2:2.29%
  • alacrity_3:1.91%
  • alacrity_4:1.70%
  • alacrity_5:88.41%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.07%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.6s
  • trigger_min/max:9.2s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.72% / 40.92%

Stack Uptimes

  • bolstering_shadows_1:37.07%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.2s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.8s / 99.9s
  • trigger_min/max:83.8s / 99.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0129.2s109.5s4.4s1.76%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.1s
  • trigger_min/max:90.0s / 187.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 10.6s
  • uptime_min/max:0.00% / 7.46%

Stack Uptimes

  • cryptic_instructions_1:1.76%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.023.1s23.1s8.2s36.47%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 69.6s
  • trigger_min/max:8.0s / 69.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:33.61% / 39.57%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.57%
  • danse_macabre_4:16.48%
  • danse_macabre_5:8.84%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.440.9s3.7s35.7s90.17%95.71%74.4 (74.4)6.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 171.6s
  • trigger_min/max:1.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.4s
  • uptime_min/max:77.34% / 96.48%

Stack Uptimes

  • deeper_daggers_1:90.17%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.44%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.6s
  • trigger_min/max:9.2s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.45% / 21.83%

Stack Uptimes

  • disorienting_strikes_1:12.25%
  • disorienting_strikes_2:6.19%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0129.0s109.3s4.1s1.69%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.0s
  • trigger_min/max:90.0s / 189.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 10.2s
  • uptime_min/max:0.00% / 7.22%

Stack Uptimes

  • errant_manaforge_emission_1:1.69%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.244.122.0s5.2s17.3s81.53%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 60.9s
  • trigger_min/max:1.0s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.7s
  • uptime_min/max:65.65% / 92.89%

Stack Uptimes

  • escalating_blade_1:24.92%
  • escalating_blade_2:22.33%
  • escalating_blade_3:22.46%
  • escalating_blade_4:11.81%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.6s90.6s14.7s18.23%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:83.0s / 180.6s
  • trigger_min/max:83.0s / 180.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:12.55% / 20.81%

Stack Uptimes

  • ethereal_powerlink_1:18.23%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.282.2s69.6s15.5s10.86%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4694.66

Trigger Details

  • interval_min/max:15.1s / 315.4s
  • trigger_min/max:0.3s / 315.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 45.3s
  • uptime_min/max:0.00% / 39.60%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.86%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.191.3s9.7s11.8s14.68%0.00%14.3 (96.7)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.5s
  • trigger_min/max:1.0s / 87.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.92% / 16.92%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.46%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.71%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.04%
  • flagellation_buff_19:0.42%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.20%
  • flagellation_buff_25:0.85%
  • flagellation_buff_26:0.37%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.12%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.9s14.26%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.3s / 98.5s
  • trigger_min/max:78.3s / 98.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.34% / 16.24%

Stack Uptimes

  • flagellation_persist_30:14.26%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6112.2s77.0s35.0s24.32%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 325.9s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.5s
  • uptime_min/max:0.00% / 75.80%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.32%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.7113.4s76.3s35.7s25.37%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 336.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 180.0s
  • uptime_min/max:0.00% / 72.09%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.37%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6113.9s77.3s34.9s24.33%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 331.9s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 72.78%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.33%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.7112.6s75.4s36.6s25.98%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 329.5s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 76.40%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.98%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.60.039.8s3.4s59.3s95.36%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.44%
  • flawless_form_2:8.82%
  • flawless_form_3:11.75%
  • flawless_form_4:9.69%
  • flawless_form_5:2.74%
  • flawless_form_6:4.40%
  • flawless_form_7:5.91%
  • flawless_form_8:11.40%
  • flawless_form_9:18.47%
  • flawless_form_10:8.91%
  • flawless_form_11:1.48%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.16%
  • flawless_form_16:0.10%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.287.1s74.6s17.0s10.89%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:6.1s / 283.4s
  • trigger_min/max:0.1s / 283.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 46.8s
  • uptime_min/max:0.00% / 39.99%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.89%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.1s74.1s16.8s10.91%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.6s / 321.8s
  • trigger_min/max:0.3s / 321.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 45.8s
  • uptime_min/max:0.00% / 40.01%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.91%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.287.8s75.1s16.7s10.55%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:5.6s / 322.2s
  • trigger_min/max:0.2s / 322.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 55.1s
  • uptime_min/max:0.00% / 37.85%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.55%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)2.00.286.4s71.7s17.1s11.22%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.4s / 305.2s
  • trigger_min/max:0.3s / 305.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 57.3s
  • uptime_min/max:0.00% / 40.10%

Stack Uptimes

  • nascent_empowerment_Vers_1:11.22%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.522.1s21.3s3.7s17.03%100.00%0.5 (0.5)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 85.4s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:9.51% / 27.69%

Stack Uptimes

  • poised_shadows_1:17.03%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.64%11.22%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 64.8s
  • trigger_min/max:1.0s / 64.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.5s
  • uptime_min/max:0.73% / 4.64%

Stack Uptimes

  • premeditation_1:2.64%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.30.0129.4s110.6s3.9s1.69%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.4s
  • trigger_min/max:90.0s / 189.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.5s
  • uptime_min/max:0.00% / 6.66%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.69%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.284.8s72.9s15.4s10.71%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23766.12

Trigger Details

  • interval_min/max:15.1s / 334.2s
  • trigger_min/max:1.0s / 334.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 44.5s
  • uptime_min/max:0.00% / 32.95%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.71%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.70.090.9s90.9s15.8s19.23%17.18%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.4s
  • trigger_min/max:90.0s / 97.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.90% / 21.86%

Stack Uptimes

  • shadow_blades_1:19.23%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.47%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 69.6s
  • trigger_min/max:8.0s / 69.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:33.61% / 39.57%

Stack Uptimes

  • shadow_dance_1:36.47%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.2138.44.4s1.4s3.5s79.06%95.46%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 46.1s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.7s
  • uptime_min/max:70.43% / 86.87%

Stack Uptimes

  • shadow_techniques_1:20.49%
  • shadow_techniques_2:20.93%
  • shadow_techniques_3:9.42%
  • shadow_techniques_4:10.48%
  • shadow_techniques_5:6.03%
  • shadow_techniques_6:5.82%
  • shadow_techniques_7:2.58%
  • shadow_techniques_8:2.30%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.45%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.01%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.8s99.32%87.94%98.8 (98.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 358.0s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.50.0101.4s94.1s9.9s1.81%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.7s / 299.4s
  • trigger_min/max:1.8s / 299.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 18.2s
  • uptime_min/max:0.00% / 12.43%

Stack Uptimes

  • storm_sewers_citrine_1:1.81%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0106.4s95.3s10.0s1.88%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:8.0s / 323.7s
  • trigger_min/max:0.3s / 323.7s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 19.0s
  • uptime_min/max:0.00% / 17.56%

Stack Uptimes

  • storm_sewers_citrine_1:1.88%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0109.0s95.2s9.9s1.86%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.3s / 322.2s
  • trigger_min/max:1.0s / 322.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.1s
  • uptime_min/max:0.00% / 17.21%

Stack Uptimes

  • storm_sewers_citrine_1:1.86%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.281.6s69.5s15.4s11.02%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1401.29
  • stat:haste_rating
  • amount:1401.29
  • stat:mastery_rating
  • amount:1401.29
  • stat:versatility_rating
  • amount:1401.29

Trigger Details

  • interval_min/max:15.1s / 317.8s
  • trigger_min/max:1.0s / 317.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 45.5s
  • uptime_min/max:0.00% / 35.97%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:11.02%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s10.97%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 65.7s
  • trigger_min/max:3.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.8s
  • uptime_min/max:8.81% / 14.22%

Stack Uptimes

  • supercharge_1_1:10.97%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.01%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.7s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s
  • uptime_min/max:0.57% / 5.19%

Stack Uptimes

  • supercharge_2_1:2.01%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.6s0.01%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:0.00% / 1.06%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.34%

Stack Uptimes

  • supercharge_4_1:0.00%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.4s21.3s24.5s61.12%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.0s / 96.5s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:55.56% / 65.15%

Stack Uptimes

  • symbols_of_death_1:61.12%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.3s307.3s27.2s13.33%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.8s
  • trigger_min/max:300.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.95% / 18.08%

Stack Uptimes

  • tempered_potion_1:13.33%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.78%22.25%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.6s / 65.7s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.1s
  • uptime_min/max:11.04% / 16.58%

Stack Uptimes

  • the_rotten_1:10.72%
  • the_rotten_2:3.06%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.3s
  • trigger_min/max:120.0s / 136.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.095.3s46.3s15.1s0.59%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4526.14

Trigger Details

  • interval_min/max:15.1s / 217.4s
  • trigger_min/max:3.0s / 217.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s
  • uptime_min/max:0.00% / 13.51%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.65%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.284.9s71.4s15.5s10.59%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5605.16

Trigger Details

  • interval_min/max:15.0s / 322.5s
  • trigger_min/max:0.3s / 322.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 48.0s
  • uptime_min/max:0.00% / 39.35%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.59%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.526.075.06.0s0.7s66.1s
Skyfury (Off Hand)49.328.077.06.0s0.7s58.7s
Supercharger secret_technique12.58.017.023.6s9.2s90.0s
Cold Blood secret_technique3.63.04.090.7s83.8s99.9s
Supercharger rupture0.20.02.0182.4s45.1s275.0s
Supercharger coup_de_grace2.70.09.076.3s9.2s319.0s
Supercharger eviscerate13.07.020.023.1s1.0s152.7s
CP Spent During Flagellation202.7145.0248.011.2s1.0s88.6s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.41%6.31%13.51%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 2
Energy RegenEnergy1,435.973,034.5034.08%2.11400.1511.65%
Improved AmbushCombo Points52.2933.554.58%0.6418.7435.84%
PremeditationCombo Points17.2157.077.79%3.3263.3952.62%
Relentless StrikesEnergy107.514,279.4548.06%39.81122.832.79%
Shadow BladesCombo Points21.96114.1215.58%5.2017.6313.38%
Shadow TechniquesEnergy359.941,233.5113.85%3.43206.2514.33%
Shadow TechniquesCombo Points85.57240.8132.88%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.32107.2114.64%7.000.000.00%
BackstabCombo Points75.4275.0810.25%1.000.340.45%
ShadowstrikeCombo Points52.29104.5514.28%2.000.030.03%
Symbols of DeathEnergy14.26356.224.00%24.98214.2937.56%
Usage Type Count Total Tot% Avg RPE APR
Combo 2
BackstabEnergy75.423,016.7933.68%40.0040.003,063.97
Coup de GraceEnergy13.32466.255.21%35.0034.9980,719.53
Coup de GraceCombo Points13.3291.0012.49%6.836.83413,586.91
EviscerateEnergy68.642,402.2426.82%35.0035.0144,915.86
EviscerateCombo Points68.64467.7164.19%6.816.82230,694.88
RuptureEnergy9.52237.982.66%25.0025.00144,413.91
RuptureCombo Points9.5265.138.94%6.846.84527,704.36
Secret TechniqueEnergy16.03480.935.37%30.0030.00164,590.45
Secret TechniqueCombo Points16.03104.7614.38%6.536.53755,612.43
ShadowstrikeEnergy52.292,353.0326.27%45.0044.9915,017.72
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.7029.88943.346.40.2100.0
Combo Points0.02.442.43100.13.80.07.0

Statistics & Data Analysis

Fight Length
Combo 2 Fight Length
Count 1217
Mean 299.79
Minimum 240.00
Maximum 359.97
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Combo 2 Damage Per Second
Count 1217
Mean 1450763.10
Minimum 1296630.25
Maximum 1623691.04
Spread ( max - min ) 327060.79
Range [ ( max - min ) / 2 * 100% ] 11.27%
Standard Deviation 49572.0888
5th Percentile 1373171.22
95th Percentile 1532544.79
( 95th Percentile - 5th Percentile ) 159373.58
Mean Distribution
Standard Deviation 1420.9930
95.00% Confidence Interval ( 1447978.00 - 1453548.19 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4486
0.1 Scale Factor Error with Delta=300 20977712
0.05 Scale Factor Error with Delta=300 83910846
0.01 Scale Factor Error with Delta=300 2097771140
Priority Target DPS
Combo 2 Priority Target Damage Per Second
Count 1217
Mean 1450763.10
Minimum 1296630.25
Maximum 1623691.04
Spread ( max - min ) 327060.79
Range [ ( max - min ) / 2 * 100% ] 11.27%
Standard Deviation 49572.0888
5th Percentile 1373171.22
95th Percentile 1532544.79
( 95th Percentile - 5th Percentile ) 159373.58
Mean Distribution
Standard Deviation 1420.9930
95.00% Confidence Interval ( 1447978.00 - 1453548.19 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4486
0.1 Scale Factor Error with Delta=300 20977712
0.05 Scale Factor Error with Delta=300 83910846
0.01 Scale Factor Error with Delta=300 2097771140
DPS(e)
Combo 2 Damage Per Second (Effective)
Count 1217
Mean 1450763.10
Minimum 1296630.25
Maximum 1623691.04
Spread ( max - min ) 327060.79
Range [ ( max - min ) / 2 * 100% ] 11.27%
Damage
Combo 2 Damage
Count 1217
Mean 434455027.98
Minimum 339121521.41
Maximum 534702057.15
Spread ( max - min ) 195580535.75
Range [ ( max - min ) / 2 * 100% ] 22.51%
DTPS
Combo 2 Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 2 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 2 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 2 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 2 Healing Taken Per Second
Count 1217
Mean 3047.52
Minimum 0.00
Maximum 9996.22
Spread ( max - min ) 9996.22
Range [ ( max - min ) / 2 * 100% ] 164.01%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.29 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.42 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.27 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.66 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.03 secret_technique,if=variable.secret
L 9.52 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.32 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.64 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.31 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.92 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNNDHNDNQFKDMDNNDNEELHQDMKDNDNDNEENEMHQDNDKDNDDNENEENEELEEEMEEENEENEEOJHQPKDNDINDMNELHQDFKDNNDNNENENHENEEMQDKDNDNDNRDLEENHEMENEEKEENENEENEELEEEMEEENEOEJHQKPDNDINDMNELHQDFKNDNNDNNEMENHQDKNDNDNDNEELENEEEMEHQKDNNDDNDNEENEKQDMDNDHN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.003Gpotion
[cds]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, realigning_nexus_convergence_divergence
0:01.003Jflagellation
[cds]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.006Neviscerate
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.010Rvanish
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(7), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.010Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(7), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Hsymbols_of_death
[cds]
Combo 2 93.4/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(2), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.029Ishadow_blades
[cds]
Combo 2 85.3/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.029Ksecret_technique
[finish]
Fluffy_Pillow 85.3/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.035Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.041Neviscerate
[finish]
Fluffy_Pillow 77.4/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.045Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.050Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.055Neviscerate
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.059Neviscerate
[finish]
Fluffy_Pillow 92.3/100 92% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.062Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.068Hsymbols_of_death
[cds]
Combo 2 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.068Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.073Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.078Neviscerate
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.082Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.082Fcold_blood
[cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), premeditation, shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.082Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(3), premeditation, shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:18.088Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(3), premeditation, shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:19.093Mcoup_de_grace
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:20.296Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:21.301Neviscerate
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:22.304Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:23.309Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:24.313Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:25.316Ebackstab
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:26.319Ebackstab
[build]
Fluffy_Pillow 82.7/100 83% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:27.324Lrupture
[finish]
Fluffy_Pillow 65.3/100 65% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(5), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:28.330Hsymbols_of_death
[cds]
Combo 2 97.9/100 98% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(7), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:28.330Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), shadow_techniques(7), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:28.330Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(7), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:29.334Mcoup_de_grace
[finish]
Fluffy_Pillow 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(10), shadow_techniques(9), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:30.538Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(14), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:31.541Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
0:32.546Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
0:33.551Dshadowstrike
[build]
Fluffy_Pillow 99.7/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:34.557Neviscerate
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:35.561Dshadowstrike
[build]
Fluffy_Pillow 91.3/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:36.568Neviscerate
[finish]
Fluffy_Pillow 68.7/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:37.572Ebackstab
[build]
Fluffy_Pillow 99.0/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:38.576Ebackstab
[build]
Fluffy_Pillow 73.7/100 74% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:39.578Neviscerate
[finish]
Fluffy_Pillow 64.7/100 65% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:40.582Ebackstab
[build]
Fluffy_Pillow 88.7/100 89% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:41.588Mcoup_de_grace
[finish]
Fluffy_Pillow 60.3/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:42.792Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:42.792Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:42.792Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
0:43.797Neviscerate
[finish]
Fluffy_Pillow 66.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:44.801Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:45.806Ksecret_technique
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:46.812Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
0:47.817Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
0:48.820Dshadowstrike
[build]
Fluffy_Pillow 85.2/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
0:49.825Dshadowstrike
[build]
Fluffy_Pillow 59.6/100 60% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
0:51.027Neviscerate
[finish]
Fluffy_Pillow 44.3/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
0:52.030Ebackstab
[build]
Fluffy_Pillow 55.7/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
0:53.034Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
0:54.040Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
0:56.408Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
0:57.996Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
0:59.001Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:02.090Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:03.975Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:04.979Ebackstab
[build]
Fluffy_Pillow 47.7/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:07.574Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:10.446Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:12.910Mcoup_de_grace
[finish]
Fluffy_Pillow 37.8/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:14.115Ebackstab
[build]
Fluffy_Pillow 76.5/100 76% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:15.118Ebackstab
[build]
Fluffy_Pillow 51.9/100 52% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:17.369Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:19.740Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:20.744Ebackstab
[build]
Fluffy_Pillow 51.8/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
1:22.839Ebackstab
[build]
Fluffy_Pillow 43.6/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:25.348Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:26.351Ebackstab
[build]
Fluffy_Pillow 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:28.609Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:29.862Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 23.3/100 23% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:31.027Jflagellation
[cds]
Fluffy_Pillow 36.5/100 37% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.031Hsymbols_of_death
[cds]
Combo 2 51.9/100 52% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(3), flagellation_buff, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.031Qshadow_dance
[stealth_cds]
Combo 2 91.9/100 92% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques(3), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.031Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 91.9/100 92% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.031Ksecret_technique
[finish]
Fluffy_Pillow 91.9/100 92% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:33.035Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:34.040Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:35.044Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.048Ishadow_blades
[cds]
Combo 2 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.048Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:37.053Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:38.059Mcoup_de_grace
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(7), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:39.265Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:40.268Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:41.273Lrupture
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:42.277Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:42.277Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:42.277Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:43.283Fcold_blood
[cds]
Combo 2 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:43.283Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:44.286Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:45.291Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:46.295Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:47.298Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:48.301Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:49.307Neviscerate
[finish]
Fluffy_Pillow 92.9/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:50.312Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:51.318Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:52.323Ebackstab
[build]
Fluffy_Pillow 81.6/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:53.329Neviscerate
[finish]
Fluffy_Pillow 60.4/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:54.334Hsymbols_of_death
[cds]
Combo 2 79.2/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:54.334Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:55.339Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:56.343Ebackstab
[build]
Fluffy_Pillow 86.6/100 87% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:57.347Ebackstab
[build]
Fluffy_Pillow 65.4/100 65% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:58.351Mcoup_de_grace
[finish]
Fluffy_Pillow 44.2/100 44% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:59.556Qshadow_dance
[stealth_cds]
Combo 2 90.1/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:59.556Dshadowstrike
[build]
Fluffy_Pillow 90.1/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), premeditation, shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:00.561Ksecret_technique
[finish]
Fluffy_Pillow 63.9/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:01.567Dshadowstrike
[build]
Fluffy_Pillow 79.7/100 80% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:02.571Neviscerate
[finish]
Fluffy_Pillow 53.5/100 54% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:03.574Dshadowstrike
[build]
Fluffy_Pillow 64.3/100 64% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:04.579Neviscerate
[finish]
Fluffy_Pillow 38.1/100 38% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:05.583Dshadowstrike
[build]
Fluffy_Pillow 56.9/100 57% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:07.017Neviscerate
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:08.021Rvanish
[stealth_cds]
Combo 2 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:08.021Dshadowstrike
[build]
Fluffy_Pillow 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, vanish, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:09.505Lrupture
[finish]
Fluffy_Pillow 25.0/100 25% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:10.509Ebackstab
[build]
Fluffy_Pillow 45.8/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:13.403Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:15.938Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:16.943Hsymbols_of_death
[cds]
Combo 2 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:16.943Ebackstab
[build]
Fluffy_Pillow 87.0/100 87% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:17.949Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:19.154Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(6), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:20.159Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:21.163Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:22.169Ebackstab
[build]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:23.175Ksecret_technique
[finish]
Fluffy_Pillow 49.6/100 50% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:24.181Ebackstab
[build]
Fluffy_Pillow 68.4/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:25.185Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:26.856Neviscerate
[finish]
Fluffy_Pillow 41.2/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:27.860Ebackstab
[build]
Fluffy_Pillow 60.0/100 60% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(7), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:28.866Neviscerate
[finish]
Fluffy_Pillow 38.8/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:29.870Ebackstab
[build]
Fluffy_Pillow 49.6/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:32.089Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:34.679Neviscerate
[finish]
Fluffy_Pillow 37.2/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:35.683Ebackstab
[build]
Fluffy_Pillow 48.0/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:38.353Ebackstab
[build]
Fluffy_Pillow 44.7/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:40.398Lrupture
[finish]
Fluffy_Pillow 30.7/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:41.402Ebackstab
[build]
Fluffy_Pillow 46.5/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:43.828Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:46.837Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:49.667Mcoup_de_grace
[finish]
Fluffy_Pillow 36.5/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:50.872Ebackstab
[build]
Fluffy_Pillow 75.2/100 75% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:51.876Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:54.211Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:56.561Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:57.566Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:59.873Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:00.000Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
3:01.004Jflagellation
[cds]
Fluffy_Pillow 14.2/100 14% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
3:02.031Hsymbols_of_death
[cds]
Combo 2 25.9/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, flagellation_buff, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
3:02.031Qshadow_dance
[stealth_cds]
Combo 2 65.9/100 66% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
3:02.031Ksecret_technique
[finish]
Fluffy_Pillow 65.9/100 66% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
3:03.036Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
3:03.036Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:04.041Neviscerate
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:05.044Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:06.049Ishadow_blades
[cds]
Combo 2 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:06.049Neviscerate
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:07.054Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:08.060Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.266Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:10.271Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:11.275Lrupture
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:12.279Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(7), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:12.279Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(7), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:12.279Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), premeditation, shadow_techniques(7), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:13.284Fcold_blood
[cds]
Combo 2 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:13.284Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:14.290Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:15.294Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:16.298Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:17.303Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:18.308Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:19.312Neviscerate
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:20.314Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:21.317Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:22.323Mcoup_de_grace
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:23.527Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(10), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:24.531Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:25.534Hsymbols_of_death
[cds]
Combo 2 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:25.534Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:25.534Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:26.540Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:27.543Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(8), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:28.548Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:29.553Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:30.555Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:31.559Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:32.564Dshadowstrike
[build]
Fluffy_Pillow 74.6/100 75% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:33.568Neviscerate
[finish]
Fluffy_Pillow 49.0/100 49% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:34.574Ebackstab
[build]
Fluffy_Pillow 68.4/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
3:35.577Ebackstab
[build]
Fluffy_Pillow 47.8/100 48% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:37.255Lrupture
[finish]
Fluffy_Pillow 34.9/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
3:38.260Ebackstab
[build]
Fluffy_Pillow 64.3/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
3:39.265Neviscerate
[finish]
Fluffy_Pillow 43.9/100 44% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
3:40.271Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
3:42.493Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
3:45.125Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
3:47.677Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(3), stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
3:48.883Ebackstab
[build]
Fluffy_Pillow 74.6/100 75% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:49.889Hsymbols_of_death
[cds]
Combo 2 49.6/100 50% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:50.023Qshadow_dance
[stealth_cds]
Combo 2 91.1/100 91% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:50.023Ksecret_technique
[finish]
Fluffy_Pillow 91.1/100 91% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:51.028Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:52.032Neviscerate
[finish]
Fluffy_Pillow 82.0/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(7), the_rotten, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:53.037Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), the_rotten, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:54.044Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:55.048Dshadowstrike
[build]
Fluffy_Pillow 73.8/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
3:56.053Neviscerate
[finish]
Fluffy_Pillow 47.6/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
3:57.056Dshadowstrike
[build]
Fluffy_Pillow 66.4/100 66% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
3:58.062Neviscerate
[finish]
Fluffy_Pillow 40.2/100 40% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
3:59.066Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:00.316Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:02.889Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(5), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:03.893Ebackstab
[build]
Fluffy_Pillow 46.8/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(5), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:05.868Ksecret_technique
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:07.028Qshadow_dance
[stealth_cds]
Combo 2 52.5/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:07.028Dshadowstrike
[build]
Fluffy_Pillow 52.5/100 53% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form, premeditation, shadow_techniques(3), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:09.691Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:10.894Dshadowstrike
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:11.899Neviscerate
[finish]
Fluffy_Pillow 43.9/100 44% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:12.905Dshadowstrike
[build]
Fluffy_Pillow 58.7/100 59% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:15.087Hsymbols_of_death
[cds]
Combo 2 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
4:15.087Neviscerate
[finish]
Fluffy_Pillow 81.1/100 81% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit20.03%20.03%5620
Haste8.16%2.79%1843
Versatility23.72%21.09%16453
Attack Power6162857457938
Mastery57.98%47.03%7838
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Ring of Dun Algaz
ilevel: 639, stats: { +13,614 Sta, +2,102 Crit, +4,028 Vers }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 2"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=ring_of_dun_algaz,id=133287,bonus_id=10390/6652/10394/10878/10383/10299/11342/10255
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=5510
# gear_haste_rating=1807
# gear_mastery_rating=7684
# gear_versatility_rating=16130
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 3 : 1,415,985 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,415,985.31,415,985.32,765.3 / 0.195%191,495.4 / 13.5%47,410.9
Resource Out In Waiting APM Active
Energy29.829.711.76%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 31,415,985
Auto Attack 0 (74,323)0.0% (5.3%)3.9122.02s5,677,6750

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 49,6013.5%353.70.98s42,00342,837Direct353.739,56379,63442,00022.2%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.72353.720.000.000.000.98050.000014,857,202.8719,373,240.0923.31%42,837.1342,837.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.43%217.3015329639,563.3524,84263,29439,582.8237,63041,6358,597,05111,210,48523.31%
crit22.23%78.624411679,633.5949,758126,77879,678.8872,92187,8466,260,1528,162,75523.31%
miss16.34%57.8034850.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 24,7231.7%352.90.99s20,98421,335Direct352.919,72339,67120,98222.4%16.2%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage352.92352.920.000.000.000.98360.00007,405,629.149,656,851.0323.31%21,334.5521,334.55
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.43%216.7814728219,723.1812,48331,51819,731.0718,77520,7204,275,5665,575,56023.32%
crit22.36%78.904311339,670.6725,07663,13039,697.9736,28643,5683,130,0634,081,29123.31%
miss16.22%57.2432910.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 31,9962.3%75.33.71s127,483126,913Direct75.375,241194,013127,48544.0%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.3275.320.000.000.001.00450.00009,601,574.9412,550,859.7723.50%126,912.63126,912.63
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.02%42.19236775,241.3359,362149,86975,253.3671,14779,7733,174,8564,151,97523.52%
crit43.98%33.121653194,012.74130,810391,137194,135.57177,214219,3746,426,7198,398,88523.50%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.31

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 90,162 (128,673)6.4% (9.1%)13.322.33s2,896,9802,405,243Direct39.8 (78.3)510,8581,025,297677,70732.4% (32.3%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3039.830.000.000.001.20450.000026,992,924.2035,137,552.6623.18%2,405,243.132,405,243.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.57%26.921442510,857.82119,0621,889,777510,760.26315,612692,86113,749,31717,899,45523.19%
crit32.43%12.923221,025,296.67238,4803,625,4041,026,044.06497,4201,868,02013,243,60717,238,09823.18%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.30
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,5112.7%0.00.00s00Direct38.5225,795456,387299,93032.1%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.470.000.000.000.00000.000011,536,665.4911,536,665.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.86%26.111241225,795.0954,059785,237226,324.65149,158320,4085,895,3235,895,3230.00%
crit32.14%12.36323456,387.24113,6941,642,164456,413.32204,341729,5185,641,3435,641,3430.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,577)0.0% (1.5%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,5771.5%22.212.85s277,7350Direct22.2277,8510277,8510.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.2122.200.000.000.000.00000.00006,168,593.716,168,593.710.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.201041277,850.57270,713310,011277,839.57272,686284,7066,168,5946,168,5940.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 257,607 (368,806)18.2% (26.0%)68.54.38s1,611,7651,604,548Direct68.5 (135.9)847,1131,725,8121,126,10831.7% (31.8%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.5068.500.000.000.001.00450.000077,118,248.19100,305,843.1223.12%1,604,547.841,604,547.84
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.25%46.753165847,113.43209,6622,329,814847,025.39660,3261,040,44539,591,80851,497,93123.12%
crit31.75%21.7510361,725,811.84419,9524,561,3541,725,234.271,175,3492,464,46737,526,44148,807,91223.11%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.51

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 111,1997.9%67.44.44s493,6790Direct67.4371,615755,028493,71331.9%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.4467.440.000.000.000.00000.000033,292,293.5333,292,293.530.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.13%45.952865371,614.9799,9551,010,756371,531.39304,720448,06017,068,02117,068,0210.00%
crit31.87%21.49737755,027.61200,2091,983,939754,368.19506,4271,031,80216,224,27216,224,2720.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,096 (22,282)0.1% (1.6%)3.791.36s1,797,8511,789,852Direct3.7 (27.6)72,015144,40888,13922.4% (22.9%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000327,488.87327,488.870.00%1,789,851.501,789,851.50
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.64%2.880472,015.2663,295136,95571,406.380101,943207,627207,6270.00%
crit22.36%0.8304144,407.59126,779282,31786,329.970274,321119,862119,8620.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 21,1861.5%0.00.00s00Direct23.9216,345430,786265,76723.0%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.890.000.000.000.00000.00006,346,867.386,346,867.380.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.98%18.391026216,344.7682,713444,972216,120.80179,097246,4583,977,4043,977,4040.00%
crit23.02%5.50115430,786.18161,542864,807430,296.40218,705703,5242,369,4642,369,4640.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,8540.9%0.00.00s00Direct282.911,10622,38713,61222.2%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00282.880.000.000.000.00000.00003,850,521.703,850,521.700.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.79%220.0615429711,106.277,80617,27711,111.5410,52411,7742,444,1392,444,1390.00%
crit22.21%62.823510322,387.3415,63634,60522,403.2319,96824,5311,406,3831,406,3830.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 99,002 (117,193)7.0% (8.3%)9.531.38s3,685,6453,669,239Periodic166.8 (333.5)133,206275,954177,81231.3% (31.2%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.520.00166.77166.777.071.00451.745029,650,334.8929,650,334.890.00%116,770.533,669,238.71
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit68.75%114.6572156133,205.65135408,651133,279.89118,296150,35515,272,92615,272,9260.00%
crit31.25%52.122880275,953.97319816,441276,368.20223,709335,53314,377,40814,377,4080.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.52
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1921.3%166.81.76s32,6770Periodic166.824,51850,68432,67931.2%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage166.770.000.00166.770.000.00000.00005,449,602.665,449,602.660.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit68.81%114.767915324,517.879,61674,93124,528.9621,49427,2332,813,1822,813,1820.00%
crit31.19%52.01298050,683.8119,260149,70350,755.6940,80765,2862,636,4212,636,4210.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (271,521)0.0% (19.2%)16.018.87s5,074,0075,051,515

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.020.000.000.000.001.00450.00000.000.000.00%5,051,515.145,051,515.14

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.02
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,8244.9%0.00.00s00Direct16.0671,5762,050,6031,305,17345.9%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.020.000.000.000.00000.000020,906,443.7727,242,467.5423.26%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit54.10%8.67115671,575.64150,1951,566,248672,993.17448,095907,8205,820,8647,603,70823.46%
crit45.90%7.363132,050,602.93299,9663,924,4762,086,969.501,347,1413,110,47215,085,58019,638,76023.18%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 201,69714.2%0.00.00s00Direct31.9975,5222,944,2651,891,43746.5%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.940.000.000.000.00000.000060,402,743.9760,402,743.970.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.50%17.09826975,522.15221,0012,374,509977,254.01702,3121,243,34116,663,91016,663,9100.00%
crit46.50%14.857252,944,264.69441,3785,675,2592,967,042.881,973,1254,503,56743,738,83443,738,8340.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (107,048)0.0% (7.6%)3.790.96s8,776,7880

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.66
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 107,0487.6%385.11.21s83,2840Periodic385.183,289083,2890.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.080.000.00385.080.000.00000.000032,070,974.6932,070,974.690.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.0829046383,288.64771,034,51583,350.0868,95598,07132,070,97532,070,9750.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:13994.91
  • base_dd_max:13994.91
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 122,2778.6%52.25.81s700,814697,678Direct52.2289,471938,800700,97263.4%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2052.200.000.000.001.00450.000036,579,976.9947,679,958.2823.28%697,678.42697,678.42
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit36.65%19.131130289,471.43135,328411,406289,484.66255,905322,8685,537,8727,214,59623.24%
crit63.35%33.072145938,799.85298,2081,390,994939,703.59854,9311,017,40531,042,10540,465,36223.29%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.19

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Suffocating Darkness 48,6023.4%19.115.23s761,7210Periodic107.5135,2850135,2850.0%0.0%71.7%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.110.00107.49107.4912.120.00002.000014,555,309.4114,555,309.410.00%67,705.730.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.4966154135,284.5263,367217,698134,574.0972,902178,52514,555,30914,555,3090.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Unseen Blade 89,8336.3%58.15.13s463,1780Direct58.1378,811762,294463,19622.0%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.0858.080.000.000.000.00000.000026,901,621.4035,124,465.4823.41%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.99%45.302864378,810.61229,417557,957379,085.60353,461410,76517,162,57922,411,23523.42%
crit22.01%12.78323762,294.39459,5231,117,588762,193.94596,033896,1439,739,04212,713,23023.40%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 3
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.68s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.57s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5306.25s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.83.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.770.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.323.16s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.280.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.28
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.321.35s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.27
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.02s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.92
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1590.5167.5s0.5s280.4s99.94%100.00%581.0 (581.0)0.1

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.2s / 347.6s
  • trigger_min/max:0.0s / 4.5s
  • trigger_pct:100.00%
  • duration_min/max:1.8s / 360.0s
  • uptime_min/max:99.14% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.35%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.3117.0s3.5s124.8s97.31%0.00%73.8 (76.5)1.3

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 336.7s
  • trigger_min/max:1.0s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 358.0s
  • uptime_min/max:86.88% / 99.44%

Stack Uptimes

  • alacrity_1:3.14%
  • alacrity_2:2.32%
  • alacrity_3:1.82%
  • alacrity_4:1.68%
  • alacrity_5:88.36%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.02%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.7s
  • trigger_min/max:9.2s / 56.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.53% / 41.73%

Stack Uptimes

  • bolstering_shadows_1:37.02%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:84.1s / 99.4s
  • trigger_min/max:84.1s / 99.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.07%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0133.0s114.2s4.4s1.84%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 331.9s
  • trigger_min/max:90.0s / 249.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.4s
  • uptime_min/max:0.00% / 6.59%

Stack Uptimes

  • cryptic_instructions_1:1.84%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.923.2s23.2s8.2s36.40%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 70.8s
  • trigger_min/max:8.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.54% / 39.05%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.52%
  • danse_macabre_4:16.52%
  • danse_macabre_5:8.78%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.240.3s3.7s35.3s90.00%95.66%74.2 (74.2)6.7

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 170.8s
  • trigger_min/max:1.0s / 40.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 157.5s
  • uptime_min/max:81.54% / 96.57%

Stack Uptimes

  • deeper_daggers_1:90.00%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.37%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.7s
  • trigger_min/max:9.2s / 56.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.58% / 21.44%

Stack Uptimes

  • disorienting_strikes_1:12.19%
  • disorienting_strikes_2:6.18%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0131.7s113.2s4.1s1.68%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.3s
  • trigger_min/max:90.0s / 187.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 10.3s
  • uptime_min/max:0.00% / 6.17%

Stack Uptimes

  • errant_manaforge_emission_1:1.68%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.022.0s5.2s17.4s81.70%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 63.3s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.8s
  • uptime_min/max:63.42% / 93.16%

Stack Uptimes

  • escalating_blade_1:25.10%
  • escalating_blade_2:22.10%
  • escalating_blade_3:22.47%
  • escalating_blade_4:12.03%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.7s18.21%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:83.2s / 181.2s
  • trigger_min/max:83.2s / 181.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s
  • uptime_min/max:12.87% / 20.80%

Stack Uptimes

  • ethereal_powerlink_1:18.21%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.4s9.7s11.8s14.67%0.00%14.4 (96.5)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.4s
  • trigger_min/max:1.0s / 88.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.82% / 16.90%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.76%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.46%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.71%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.38%
  • flagellation_buff_21:0.30%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.86%
  • flagellation_buff_26:0.38%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.19%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.12%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.2s91.2s11.9s14.25%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.1s / 98.4s
  • trigger_min/max:78.1s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.39% / 16.24%

Stack Uptimes

  • flagellation_persist_30:14.25%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.7111.2s75.8s35.6s25.38%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 75.23%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.38%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6110.5s76.0s35.0s24.49%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 353.6s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 82.23%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.49%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.20.6110.9s78.0s35.0s25.33%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.3s / 345.3s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 75.19%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.33%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6109.6s76.5s35.0s24.81%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.6s / 314.8s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 71.70%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.81%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.40.040.8s3.4s59.9s95.37%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.60%
  • flawless_form_2:8.83%
  • flawless_form_3:11.74%
  • flawless_form_4:9.68%
  • flawless_form_5:2.70%
  • flawless_form_6:4.46%
  • flawless_form_7:5.88%
  • flawless_form_8:11.44%
  • flawless_form_9:18.46%
  • flawless_form_10:8.78%
  • flawless_form_11:1.43%
  • flawless_form_12:0.08%
  • flawless_form_13:0.00%
  • flawless_form_14:0.01%
  • flawless_form_15:0.16%
  • flawless_form_16:0.10%
  • flawless_form_17:0.02%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.286.7s74.3s17.0s10.98%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.4s / 324.7s
  • trigger_min/max:0.4s / 324.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.7s
  • uptime_min/max:0.00% / 46.25%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.98%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.288.5s73.6s17.1s10.97%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.9s / 345.3s
  • trigger_min/max:0.3s / 345.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.0s
  • uptime_min/max:0.00% / 39.47%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.97%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.285.1s71.6s17.1s11.01%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.3s / 300.1s
  • trigger_min/max:0.2s / 300.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 74.7s
  • uptime_min/max:0.00% / 36.93%

Stack Uptimes

  • nascent_empowerment_Mastery_1:11.01%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)2.00.286.8s73.3s16.8s11.04%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.4s / 305.6s
  • trigger_min/max:0.4s / 305.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.4s
  • uptime_min/max:0.00% / 37.01%

Stack Uptimes

  • nascent_empowerment_Vers_1:11.04%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.6s16.91%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.2s / 84.5s
  • trigger_min/max:1.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:8.92% / 27.78%

Stack Uptimes

  • poised_shadows_1:16.91%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.59%11.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.9s
  • trigger_min/max:1.0s / 65.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.4s
  • uptime_min/max:0.79% / 4.40%

Stack Uptimes

  • premeditation_1:2.59%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0129.6s108.3s4.0s1.65%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 281.1s
  • trigger_min/max:90.0s / 187.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.4s
  • uptime_min/max:0.00% / 6.58%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.65%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.70.090.9s90.9s15.8s19.22%17.20%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.5s
  • trigger_min/max:90.0s / 97.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.86% / 21.86%

Stack Uptimes

  • shadow_blades_1:19.22%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.40%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 70.8s
  • trigger_min/max:8.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.54% / 39.05%

Stack Uptimes

  • shadow_dance_1:36.40%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.0138.34.4s1.5s3.5s79.08%95.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 44.9s
  • trigger_min/max:0.5s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.8s
  • uptime_min/max:70.98% / 85.94%

Stack Uptimes

  • shadow_techniques_1:20.56%
  • shadow_techniques_2:20.89%
  • shadow_techniques_3:9.25%
  • shadow_techniques_4:10.56%
  • shadow_techniques_5:6.03%
  • shadow_techniques_6:5.88%
  • shadow_techniques_7:2.56%
  • shadow_techniques_8:2.33%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.8s99.32%85.99%98.8 (98.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 358.0s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.60.0110.7s105.8s9.9s1.87%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:2.0s / 333.5s
  • trigger_min/max:2.9s / 333.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.0s
  • uptime_min/max:0.00% / 12.13%

Stack Uptimes

  • storm_sewers_citrine_1:1.87%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0109.9s98.8s10.0s1.88%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 299.3s
  • trigger_min/max:1.0s / 299.3s
  • trigger_pct:100.00%
  • duration_min/max:1.5s / 19.0s
  • uptime_min/max:0.00% / 15.92%

Stack Uptimes

  • storm_sewers_citrine_1:1.88%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.095.0s90.2s9.9s2.00%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 336.7s
  • trigger_min/max:1.0s / 336.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 18.7s
  • uptime_min/max:0.00% / 17.23%

Stack Uptimes

  • storm_sewers_citrine_1:2.00%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.3s21.3s2.3s10.98%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 68.2s
  • trigger_min/max:3.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s
  • uptime_min/max:8.83% / 13.78%

Stack Uptimes

  • supercharge_1_1:10.98%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.04%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 68.2s
  • trigger_min/max:1.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.7s
  • uptime_min/max:0.72% / 5.25%

Stack Uptimes

  • supercharge_2_1:2.04%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.34%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.943.8s21.3s24.7s61.10%100.00%6.9 (6.9)6.8

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.2s / 97.5s
  • trigger_min/max:1.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.0s
  • uptime_min/max:58.31% / 65.60%

Stack Uptimes

  • symbols_of_death_1:61.10%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.3s307.3s27.2s13.33%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.3s
  • trigger_min/max:300.0s / 329.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s
  • uptime_min/max:9.95% / 18.09%

Stack Uptimes

  • tempered_potion_1:13.33%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.81%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.3s21.3s2.9s13.76%22.29%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 68.2s
  • trigger_min/max:1.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.5s
  • uptime_min/max:10.55% / 16.72%

Stack Uptimes

  • the_rotten_1:10.73%
  • the_rotten_2:3.03%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.3s122.3s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.5s
  • trigger_min/max:120.0s / 136.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.45%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.524.084.06.0s0.7s74.6s
Skyfury (Off Hand)49.226.074.06.0s0.7s57.6s
Supercharger secret_technique12.57.016.023.7s9.2s89.3s
Cold Blood secret_technique3.63.04.090.7s84.1s99.4s
Supercharger rupture0.30.02.0194.4s49.8s281.9s
Supercharger coup_de_grace2.80.07.077.9s8.2s318.1s
Supercharger eviscerate12.97.021.023.2s1.0s145.1s
CP Spent During Flagellation202.5140.0247.011.2s1.0s89.4s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.32%6.02%14.20%0.7s0.0s2.4s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 3
Energy RegenEnergy1,427.253,029.8934.08%2.12395.2511.54%
Improved AmbushCombo Points52.1933.314.56%0.6418.8836.18%
PremeditationCombo Points17.1856.867.78%3.3163.4252.73%
Relentless StrikesEnergy107.364,272.4048.06%39.80122.912.80%
Shadow BladesCombo Points21.96113.9915.59%5.1917.7513.47%
Shadow TechniquesEnergy359.121,232.3013.86%3.43204.2014.21%
Shadow TechniquesCombo Points85.38240.3732.88%2.820.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.32107.2414.67%7.000.000.00%
BackstabCombo Points75.3174.9110.25%0.990.400.53%
ShadowstrikeCombo Points52.19104.3514.27%2.000.020.02%
Symbols of DeathEnergy14.26354.783.99%24.87215.7437.81%
Usage Type Count Total Tot% Avg RPE APR
Combo 3
BackstabEnergy75.313,012.4333.68%40.0040.003,187.32
Coup de GraceEnergy13.30465.545.21%35.0035.0082,763.75
Coup de GraceCombo Points13.3090.7812.48%6.836.83424,422.92
EviscerateEnergy68.512,397.7726.81%35.0035.0046,047.17
EviscerateCombo Points68.51466.6964.17%6.816.81236,582.19
RuptureEnergy9.52238.082.66%25.0025.00147,429.33
RuptureCombo Points9.5265.158.96%6.846.84538,744.65
Secret TechniqueEnergy16.02480.715.38%30.0030.00169,144.69
Secret TechniqueCombo Points16.02104.7014.39%6.536.53776,618.00
ShadowstrikeEnergy52.192,348.4626.26%45.0044.9915,576.17
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6529.83937.546.40.6100.0
Combo Points0.02.442.43100.43.70.07.0

Statistics & Data Analysis

Fight Length
Combo 3 Fight Length
Count 1217
Mean 299.79
Minimum 240.00
Maximum 359.97
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Combo 3 Damage Per Second
Count 1217
Mean 1415985.32
Minimum 1246649.97
Maximum 1571884.76
Spread ( max - min ) 325234.80
Range [ ( max - min ) / 2 * 100% ] 11.48%
Standard Deviation 49219.1469
5th Percentile 1333152.56
95th Percentile 1496762.57
( 95th Percentile - 5th Percentile ) 163610.01
Mean Distribution
Standard Deviation 1410.8758
95.00% Confidence Interval ( 1413220.06 - 1418750.59 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4642
0.1 Scale Factor Error with Delta=300 20680062
0.05 Scale Factor Error with Delta=300 82720248
0.01 Scale Factor Error with Delta=300 2068006183
Priority Target DPS
Combo 3 Priority Target Damage Per Second
Count 1217
Mean 1415985.32
Minimum 1246649.97
Maximum 1571884.76
Spread ( max - min ) 325234.80
Range [ ( max - min ) / 2 * 100% ] 11.48%
Standard Deviation 49219.1469
5th Percentile 1333152.56
95th Percentile 1496762.57
( 95th Percentile - 5th Percentile ) 163610.01
Mean Distribution
Standard Deviation 1410.8758
95.00% Confidence Interval ( 1413220.06 - 1418750.59 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4642
0.1 Scale Factor Error with Delta=300 20680062
0.05 Scale Factor Error with Delta=300 82720248
0.01 Scale Factor Error with Delta=300 2068006183
DPS(e)
Combo 3 Damage Per Second (Effective)
Count 1217
Mean 1415985.32
Minimum 1246649.97
Maximum 1571884.76
Spread ( max - min ) 325234.80
Range [ ( max - min ) / 2 * 100% ] 11.48%
Damage
Combo 3 Damage
Count 1217
Mean 424015017.80
Minimum 336068419.07
Maximum 516333237.41
Spread ( max - min ) 180264818.34
Range [ ( max - min ) / 2 * 100% ] 21.26%
DTPS
Combo 3 Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 3 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 3 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 3 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 3 Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.19 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.31 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.27 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.66 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.02 secret_technique,if=variable.secret
L 9.52 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.30 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.51 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.28 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.92 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNNDHMDFKNENNENENENHQDKNDMDNDLEENHQDKNDDNDMQDNDNDKDNENEELEEEMEENEEENEOEJHQKPDMDINNDNELHNQDFKDNNDMDNNHENENENEEEQKDNDNDLRDMEHNENEEKEENENEENEELEEEMEEENEOEEJHQPKDINDNNDMLHQDNDFKNDNDNNEMHQDNDKDNDNEENEMELEEENEHQKDNDNDNDNENEEMEEEQKDHN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.006Gpotion
[cds]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.006Jflagellation
[cds]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.009Neviscerate
[finish]
Fluffy_Pillow 91.8/100 92% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(6), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Rvanish
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion, storm_sewers_citrine
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(9), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion, storm_sewers_citrine
0:04.018Lrupture
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion, storm_sewers_citrine
0:05.022Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion, storm_sewers_citrine
0:05.022Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion, storm_sewers_citrine
0:05.022Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion, storm_sewers_citrine
0:05.022Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:06.026Ishadow_blades
[cds]
Combo 3 69.8/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:06.026Ksecret_technique
[finish]
Fluffy_Pillow 69.8/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:07.032Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:08.037Neviscerate
[finish]
Fluffy_Pillow 78.0/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:09.042Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:10.046Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:11.050Neviscerate
[finish]
Fluffy_Pillow 78.2/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion, storm_sewers_citrine
0:12.054Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:13.058Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:14.063Hsymbols_of_death
[cds]
Combo 3 78.9/100 79% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:14.063Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, flawless_form(4), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:15.268Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:16.273Fcold_blood
[cds]
Combo 3 79.1/100 79% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:16.273Ksecret_technique
[finish]
Fluffy_Pillow 79.1/100 79% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:17.278Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:18.283Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:19.286Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, tempered_potion
0:20.290Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, tempered_potion
0:21.296Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, tempered_potion
0:22.301Neviscerate
[finish]
Fluffy_Pillow 92.1/100 92% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, tempered_potion
0:23.306Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, tempered_potion
0:24.310Neviscerate
[finish]
Fluffy_Pillow 84.1/100 84% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, tempered_potion
0:25.314Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(8), deeper_daggers, nascent_empowerment_Crit, tempered_potion
0:26.319Neviscerate
[finish]
Fluffy_Pillow 91.4/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, tempered_potion
0:27.324Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), deeper_daggers, nascent_empowerment_Crit, tempered_potion
0:27.324Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, tempered_potion
0:27.324Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, tempered_potion
0:28.330Ksecret_technique
[finish]
Fluffy_Pillow 78.4/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, tempered_potion
0:29.334Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(4), shadow_techniques, the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, tempered_potion
0:30.337Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, tempered_potion
0:31.341Mcoup_de_grace
[finish]
Fluffy_Pillow 78.2/100 78% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:32.545Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:33.549Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:34.553Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:35.557Lrupture
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:36.560Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:37.564Ebackstab
[build]
Fluffy_Pillow 82.0/100 82% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:38.568Neviscerate
[finish]
Fluffy_Pillow 72.1/100 72% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:39.573Hsymbols_of_death
[cds]
Combo 3 94.1/100 94% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:39.573Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:39.573Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:40.579Ksecret_technique
[finish]
Fluffy_Pillow 75.2/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:41.583Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:42.586Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:43.591Dshadowstrike
[build]
Fluffy_Pillow 73.8/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:44.597Neviscerate
[finish]
Fluffy_Pillow 47.6/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:45.602Dshadowstrike
[build]
Fluffy_Pillow 66.4/100 66% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:46.606Mcoup_de_grace
[finish]
Fluffy_Pillow 40.2/100 40% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:47.810Qshadow_dance
[stealth_cds]
Combo 3 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:47.810Dshadowstrike
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:48.815Neviscerate
[finish]
Fluffy_Pillow 51.9/100 52% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
0:49.820Dshadowstrike
[build]
Fluffy_Pillow 78.7/100 79% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(10), deeper_daggers, flask_of_alchemical_chaos_vers
0:50.825Neviscerate
[finish]
Fluffy_Pillow 44.5/100 45% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
0:51.831Dshadowstrike
[build]
Fluffy_Pillow 63.3/100 63% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(8), deeper_daggers, flask_of_alchemical_chaos_vers
0:52.835Ksecret_technique
[finish]
Fluffy_Pillow 37.1/100 37% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
0:53.838Dshadowstrike
[build]
Fluffy_Pillow 60.9/100 61% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:54.965Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:55.969Ebackstab
[build]
Fluffy_Pillow 54.8/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:57.921Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:58.924Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:01.375Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
1:03.151Lrupture
[finish]
Fluffy_Pillow 28.0/100 28% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:04.155Ebackstab
[build]
Fluffy_Pillow 43.8/100 44% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:07.166Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, flask_of_alchemical_chaos_haste
1:10.338Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques, flask_of_alchemical_chaos_haste
1:12.751Mcoup_de_grace
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(2), shadow_techniques(2), nascent_empowerment_Vers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:13.955Ebackstab
[build]
Fluffy_Pillow 77.4/100 77% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(7), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:14.959Ebackstab
[build]
Fluffy_Pillow 52.4/100 52% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:16.944Neviscerate
[finish]
Fluffy_Pillow 38.0/100 38% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:17.949Ebackstab
[build]
Fluffy_Pillow 48.1/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:20.485Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:23.848Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:26.222Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade(2), flawless_form(2), shadow_techniques(2), nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:27.227Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:29.995Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:30.000Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:31.005Jflagellation
[cds]
Fluffy_Pillow 16.7/100 17% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:32.010Hsymbols_of_death
[cds]
Combo 3 27.9/100 28% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(3), shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:32.010Qshadow_dance
[stealth_cds]
Combo 3 67.9/100 68% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:32.010Ksecret_technique
[finish]
Fluffy_Pillow 67.9/100 68% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:33.015Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 97.2/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.015Dshadowstrike
[build]
Fluffy_Pillow 97.2/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:34.020Mcoup_de_grace
[finish]
Fluffy_Pillow 71.5/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:35.226Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.229Ishadow_blades
[cds]
Combo 3 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:36.229Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:37.234Neviscerate
[finish]
Fluffy_Pillow 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:38.237Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:39.241Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:40.246Ebackstab
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:41.251Lrupture
[finish]
Fluffy_Pillow 71.5/100 72% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:42.256Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:42.256Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.260Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.260Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:44.262Fcold_blood
[cds]
Combo 3 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:44.262Ksecret_technique
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.266Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.270Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:47.273Neviscerate
[finish]
Fluffy_Pillow 84.7/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:48.277Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:49.282Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:50.487Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:51.491Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:52.497Neviscerate
[finish]
Fluffy_Pillow 93.8/100 94% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:53.502Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:53.502Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:54.505Neviscerate
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques, the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:55.510Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:56.514Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:57.519Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:58.524Neviscerate
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:59.528Ebackstab
[build]
Fluffy_Pillow 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:00.534Ebackstab
[build]
Fluffy_Pillow 62.2/100 62% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:01.538Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:02.545Qshadow_dance
[stealth_cds]
Combo 3 13.0/100 13% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:03.572Ksecret_technique
[finish]
Fluffy_Pillow 32.6/100 33% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:04.578Dshadowstrike
[build]
Fluffy_Pillow 49.0/100 49% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:06.024Neviscerate
[finish]
Fluffy_Pillow 36.8/100 37% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:07.028Dshadowstrike
[build]
Fluffy_Pillow 48.8/100 49% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:09.038Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:10.043Dshadowstrike
[build]
Fluffy_Pillow 46.6/100 47% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:11.810Lrupture
[finish]
Fluffy_Pillow 25.7/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:12.814Rvanish
[stealth_cds]
Combo 3 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:12.814Dshadowstrike
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:15.045Mcoup_de_grace
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:16.248Ebackstab
[build]
Fluffy_Pillow 82.0/100 82% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:17.254Hsymbols_of_death
[cds]
Combo 3 53.5/100 53% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:17.254Neviscerate
[finish]
Fluffy_Pillow 93.5/100 93% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:18.259Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
2:19.265Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(6), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:20.269Ebackstab
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:21.274Ebackstab
[build]
Fluffy_Pillow 65.2/100 65% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:22.279Ksecret_technique
[finish]
Fluffy_Pillow 44.7/100 45% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:23.283Ebackstab
[build]
Fluffy_Pillow 64.1/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:24.288Ebackstab
[build]
Fluffy_Pillow 43.5/100 43% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:26.248Neviscerate
[finish]
Fluffy_Pillow 41.7/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:27.253Ebackstab
[build]
Fluffy_Pillow 53.1/100 53% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:28.544Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:29.548Ebackstab
[build]
Fluffy_Pillow 50.2/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:31.599Ebackstab
[build]
Fluffy_Pillow 45.5/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:33.972Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:34.977Ebackstab
[build]
Fluffy_Pillow 51.9/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:37.309Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:39.244Lrupture
[finish]
Fluffy_Pillow 25.9/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:40.247Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:42.707Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_crit
2:45.686Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_crit
2:48.489Mcoup_de_grace
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_crit
2:49.696Ebackstab
[build]
Fluffy_Pillow 73.2/100 73% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:50.700Ebackstab
[build]
Fluffy_Pillow 48.0/100 48% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:53.411Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:56.291Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:57.296Ebackstab
[build]
Fluffy_Pillow 46.9/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
3:00.099Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
3:00.099Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_crit
3:03.090Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_crit
3:04.094Jflagellation
[cds]
Fluffy_Pillow 11.9/100 12% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_crit
3:05.100Hsymbols_of_death
[cds]
Combo 3 26.7/100 27% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flagellation_buff, cryptic_instructions, flask_of_alchemical_chaos_crit
3:05.100Qshadow_dance
[stealth_cds]
Combo 3 66.7/100 67% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_crit
3:05.100Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.7/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_crit
3:05.100Ksecret_technique
[finish]
Fluffy_Pillow 66.7/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:06.104Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(11), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:07.109Ishadow_blades
[cds]
Combo 3 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:07.109Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:08.115Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(7), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.121Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(9), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:10.126Neviscerate
[finish]
Fluffy_Pillow 93.8/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_buff(28), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:11.130Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:12.134Mcoup_de_grace
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:13.338Lrupture
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:14.341Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:14.341Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:14.341Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:15.346Neviscerate
[finish]
Fluffy_Pillow 67.0/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(5), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:16.351Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:17.356Fcold_blood
[cds]
Combo 3 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:17.356Ksecret_technique
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:18.361Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:19.367Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:20.372Neviscerate
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:21.377Dshadowstrike
[build]
Fluffy_Pillow 94.9/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:22.381Neviscerate
[finish]
Fluffy_Pillow 69.9/100 70% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:23.386Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:24.390Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:25.393Mcoup_de_grace
[finish]
Fluffy_Pillow 87.9/100 88% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:26.597Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:26.597Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:26.597Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:27.600Neviscerate
[finish]
Fluffy_Pillow 66.9/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:28.605Dshadowstrike
[build]
Fluffy_Pillow 93.9/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:29.609Ksecret_technique
[finish]
Fluffy_Pillow 76.8/100 77% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:30.613Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:31.617Neviscerate
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:32.624Dshadowstrike
[build]
Fluffy_Pillow 94.5/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:33.630Neviscerate
[finish]
Fluffy_Pillow 68.9/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:34.635Ebackstab
[build]
Fluffy_Pillow 80.3/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:35.640Ebackstab
[build]
Fluffy_Pillow 67.5/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:36.646Neviscerate
[finish]
Fluffy_Pillow 46.3/100 46% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
3:37.649Ebackstab
[build]
Fluffy_Pillow 73.1/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(9), deeper_daggers, flask_of_alchemical_chaos_crit
3:38.655Mcoup_de_grace
[finish]
Fluffy_Pillow 43.9/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
3:39.859Ebackstab
[build]
Fluffy_Pillow 89.8/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
3:40.864Lrupture
[finish]
Fluffy_Pillow 60.6/100 61% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_crit
3:41.868Ebackstab
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:42.872Ebackstab
[build]
Fluffy_Pillow 55.2/100 55% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:44.553Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:47.075Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:48.077Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:49.891Hsymbols_of_death
[cds]
Combo 3 30.6/100 31% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:50.023Qshadow_dance
[stealth_cds]
Combo 3 72.1/100 72% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(5), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:50.023Ksecret_technique
[finish]
Fluffy_Pillow 72.1/100 72% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(5), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:51.026Dshadowstrike
[build]
Fluffy_Pillow 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:52.031Neviscerate
[finish]
Fluffy_Pillow 64.6/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:53.035Dshadowstrike
[build]
Fluffy_Pillow 98.4/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:54.040Neviscerate
[finish]
Fluffy_Pillow 72.2/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:55.043Dshadowstrike
[build]
Fluffy_Pillow 83.0/100 83% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:56.046Neviscerate
[finish]
Fluffy_Pillow 56.8/100 57% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:57.050Dshadowstrike
[build]
Fluffy_Pillow 75.6/100 76% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:58.056Neviscerate
[finish]
Fluffy_Pillow 49.4/100 49% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
3:59.059Ebackstab
[build]
Fluffy_Pillow 68.2/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
4:00.063Neviscerate
[finish]
Fluffy_Pillow 47.0/100 47% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
4:01.068Ebackstab
[build]
Fluffy_Pillow 60.8/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
4:02.967Ebackstab
[build]
Fluffy_Pillow 49.2/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:05.017Mcoup_de_grace
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:06.221Ebackstab
[build]
Fluffy_Pillow 77.1/100 77% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
4:07.226Ebackstab
[build]
Fluffy_Pillow 47.9/100 48% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_mastery
4:09.946Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:11.109Qshadow_dance
[stealth_cds]
Combo 3 17.7/100 18% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:11.997Ksecret_technique
[finish]
Fluffy_Pillow 31.2/100 31% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
4:13.002Dshadowstrike
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:15.037Hsymbols_of_death
[cds]
Combo 3 27.9/100 28% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(3), bolstering_shadows, flask_of_alchemical_chaos_mastery
4:15.037Neviscerate
[finish]
Fluffy_Pillow 67.9/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(3), the_rotten(2), poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520340936324701238249
Intellect12000012360120000
Spirit00000
Health681872064940200
Energy1001000
Combo Points770
Spell Power12360120000
Crit19.61%20.03%5620
Haste8.16%2.79%1843
Versatility29.68%27.06%21108
Attack Power6162857457938
Mastery58.92%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 638.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Finger2 Ring of Dun Algaz
ilevel: 639, stats: { +13,614 Sta, +2,102 Crit, +4,028 Vers }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 3"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
finger2=ring_of_dun_algaz,id=133287,bonus_id=10390/6652/10394/10878/10383/10299/11342/10255
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=637.81
# gear_agility=36181
# gear_stamina=238249
# gear_attack_power=938
# gear_crit_rating=5510
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=20694
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Messerknecht : 1,464,263 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,464,262.81,464,262.82,857.2 / 0.195%195,718.2 / 13.4%48,994.5
Resource Out In Waiting APM Active
Energy29.929.711.69%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Messerknecht1,464,263
Auto Attack 0 (70,148)0.0% (4.8%)3.9122.39s5,351,7680

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,7993.2%354.40.98s39,54940,431Direct354.438,39577,33039,55019.2%16.5%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.45354.450.000.000.000.97820.000014,018,274.0518,291,726.2823.36%40,430.5340,430.53
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.28%227.8315629838,395.0224,73264,32238,415.3436,64240,2838,747,44011,414,82223.37%
crit19.23%68.163710077,329.7350,126128,83677,375.7170,80786,5295,270,8346,876,90423.35%
miss16.49%58.4533900.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3491.6%353.80.98s19,76620,144Direct353.819,12638,56519,76319.4%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.79353.790.000.000.000.98130.00006,993,020.329,124,839.4723.36%20,143.5120,143.51
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.22%227.2016030319,126.2611,33032,03019,133.9318,01620,1444,345,2295,670,10123.36%
crit19.40%68.65409938,565.2924,53164,15538,598.1134,56442,9092,647,7913,454,73823.36%
miss16.38%57.9434870.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,1882.1%75.43.69s120,192119,654Direct75.472,926188,721120,15340.8%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.4175.410.000.000.001.00450.00009,064,296.6211,860,979.9623.58%119,654.36119,654.36
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit59.19%44.64266772,925.8757,139135,09872,940.5968,70577,1883,255,5504,262,91223.62%
crit40.81%30.771352188,720.64125,912400,230188,864.22170,564206,4185,808,7467,598,06823.57%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.41

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,047 (127,093)6.1% (8.7%)13.322.60s2,871,0502,383,651Direct39.7 (77.9)518,3001,040,797671,52329.3% (29.3%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2539.710.000.000.001.20450.000026,669,266.6934,723,453.9323.20%2,383,650.572,383,650.57
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.69%28.071542518,299.80119,7431,937,718518,425.53343,807732,88014,547,79618,941,81123.20%
crit29.31%11.642221,040,797.19239,8463,581,5561,041,190.64545,9551,795,21512,121,47115,781,64323.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.25
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,0462.6%0.00.00s00Direct38.2230,071463,644298,22529.2%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.170.000.000.000.00000.000011,385,714.6411,385,714.640.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.79%27.021441230,070.5557,087840,651230,211.00153,850313,0696,215,2156,215,2150.00%
crit29.21%11.15222463,643.81114,3451,613,385464,498.59224,105781,5795,170,5005,170,5000.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,164)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,1641.4%22.412.91s269,6430Direct22.4269,7050269,7050.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.4322.420.000.000.000.00000.00006,047,143.476,047,143.470.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.421241269,704.94260,578314,597269,703.85262,895279,1566,047,1436,047,1430.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 256,005 (366,497)17.5% (25.0%)68.54.37s1,601,3671,594,192Direct68.5 (135.7)859,1331,755,5611,119,00329.0% (29.0%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.4868.480.000.000.001.00450.000076,603,486.9199,651,815.1523.13%1,594,192.481,594,192.48
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.02%48.643266859,133.21210,8622,472,406859,121.28712,4731,007,83841,769,68354,338,07523.13%
crit28.98%19.858371,755,561.41422,3574,984,6011,757,377.011,160,4552,442,31434,833,80445,313,74023.13%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.48

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,4917.5%67.24.46s492,2940Direct67.2376,595775,192492,58729.1%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.1767.170.000.000.000.00000.000033,065,796.0733,065,796.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.92%47.643267376,595.08100,5271,079,629376,649.08312,961442,75417,934,96617,934,9660.00%
crit29.08%19.53636775,191.57201,3562,108,720774,948.36502,7291,032,52415,130,83015,130,8300.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,035 (21,030)0.1% (1.4%)3.791.45s1,697,9161,690,656Direct3.7 (27.6)69,868140,00683,38019.2% (19.7%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000309,488.35309,488.350.00%1,690,655.621,690,655.62
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.84%3.000469,868.3060,925139,33169,654.370100,407209,819209,8190.00%
crit19.16%0.7103140,006.47122,033254,71175,308.230254,71199,66999,6690.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 19,9961.4%0.00.00s00Direct23.9209,797418,894251,00219.7%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.890.000.000.000.00000.00005,996,657.115,996,657.110.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.27%19.181127209,797.4973,943452,357209,641.60179,209247,6804,023,2544,023,2540.00%
crit19.73%4.71013418,894.15172,269877,535416,182.990659,5761,973,4031,973,4030.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,1900.8%0.00.00s00Direct282.610,79221,74412,91719.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00282.630.000.000.000.00000.00003,650,631.463,650,631.460.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.60%227.7914930510,791.767,51417,55710,796.1810,10311,4062,458,3392,458,3390.00%
crit19.40%54.84319021,743.8115,05135,16721,751.6119,44125,2421,192,2921,192,2920.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,807 (116,992)6.7% (8.0%)9.631.27s3,667,1133,650,795Periodic167.3 (334.6)135,604282,013176,94228.2% (28.3%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.560.00167.28167.287.081.00451.740829,597,534.1329,597,534.130.00%116,498.353,650,795.35
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.76%120.0584156135,604.42141436,751135,680.53118,984152,54516,277,22116,277,2210.00%
crit28.24%47.242775282,013.49321834,848282,264.63212,804348,37713,320,31313,320,3130.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.55
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1851.2%167.31.76s32,5580Periodic167.324,98351,65832,56128.4%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.280.000.00167.280.000.00000.00005,446,450.465,446,450.460.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.58%119.758616524,982.629,67180,08324,997.8021,91428,2872,991,5622,991,5620.00%
crit28.42%47.53248051,658.4919,371155,32851,702.7041,44564,7582,454,8892,454,8890.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (271,609)0.0% (18.6%)16.018.96s5,081,6615,058,851

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.010.000.000.000.001.00450.00000.000.000.00%5,058,850.835,058,850.83

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.01
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,6854.8%0.00.00s00Direct16.0687,3722,112,8051,303,75643.2%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.010.000.000.000.00000.000020,876,295.2327,215,967.2023.29%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.77%9.09414687,371.63151,0721,572,799688,747.20368,784990,6456,249,8908,172,92323.54%
crit43.23%6.923142,112,804.62311,6764,189,2552,150,702.811,338,6493,245,91914,626,40519,043,04523.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 201,92413.8%0.00.00s00Direct31.9994,0773,040,2251,894,92044.0%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.940.000.000.000.00000.000060,505,438.0060,505,438.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.01%17.891026994,077.10221,6202,369,949995,183.13739,9911,287,94317,781,48717,781,4870.00%
crit43.99%14.056243,040,224.81446,6846,058,1613,068,032.462,167,9104,711,82542,723,95142,723,9510.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,707)0.0% (7.2%)3.690.94s8,596,3720

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,7077.2%384.91.20s81,5270Periodic384.981,540081,5400.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage384.860.000.00384.860.000.00000.000031,376,405.8031,376,405.800.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%384.8628946881,539.96401,130,50781,587.0369,11299,04331,376,40631,376,4060.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1830.43
  • base_dd_max:1830.43
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,8308.0%52.35.83s673,726670,708Direct52.3280,609916,065673,75761.9%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.3152.310.000.000.001.00450.000035,243,025.6645,956,683.5723.31%670,708.06670,708.06
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.12%19.94930280,609.00130,261418,086280,706.41251,851314,9495,595,2977,289,75523.25%
crit61.88%32.372147916,064.86287,0431,413,579916,953.47846,137994,65329,647,72838,666,92823.33%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.29

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,7860.3%2.476.04s479,9450Direct2.4400,873803,998479,99619.7%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.362.360.000.000.000.00000.00001,134,201.281,134,201.280.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.31%1.9007400,873.13377,346478,623340,346.430467,532760,209760,2090.00%
crit19.69%0.4704803,998.48755,824946,038298,383.110925,808373,992373,9920.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8290.1%2.369.48s108,7790Direct2.391,367184,413108,76218.7%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.292.290.000.000.000.00000.0000249,110.48249,110.480.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.31%1.860791,367.0183,958120,19377,332.480117,978170,139170,1390.00%
crit18.69%0.4304184,413.34168,168232,07163,550.000232,07178,97278,9720.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71813.22
  • base_dd_max:71813.22
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,4383.2%19.215.44s740,0030Periodic107.2132,7100132,7100.0%0.0%71.5%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.240.00107.23107.2312.330.00002.000014,236,396.1914,236,396.190.00%66,383.140.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.2363151132,710.3360,995221,233131,634.7179,715184,15214,236,39614,236,3960.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 64,1264.4%32.39.20s596,0520Direct32.3499,2591,001,919595,91519.3%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.2532.250.000.000.000.00000.000019,223,548.0719,223,548.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.75%26.041049499,259.31453,001860,851498,950.88467,977546,53913,001,87813,001,8780.00%
crit19.25%6.210171,001,918.69907,3601,753,706998,615.2101,361,0416,221,6706,221,6700.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4630.3%2.370.59s573,2650Direct2.3481,349968,095573,59318.9%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.332.330.000.000.000.00000.00001,334,478.071,334,478.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.12%1.8908481,349.10452,539572,716408,826.850562,405909,022909,0220.00%
crit18.88%0.4403968,094.95906,4361,171,054342,750.0701,171,054425,456425,4560.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,1735.8%58.05.21s440,0430Direct58.0367,853740,492439,95919.4%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.9857.980.000.000.000.00000.000025,513,810.5033,332,765.9823.46%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.63%46.753164367,853.08220,828567,016368,106.74341,677404,50917,197,18022,469,41823.47%
crit19.37%11.23322740,491.83442,3191,135,733740,451.50578,897912,0288,316,63110,863,34823.45%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Messerknecht
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.77s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.58
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.20s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.511.47s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.470.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.377.89s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.340.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.466.24s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.360.0055.240.000.320.00000.83510.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5306.22s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.83.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.780.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.461.14s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.350.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.19s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.30
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.369.48s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.292.290.000.000.000.00000.00000.001,570,705.290.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.29080.00000.000001,570,70589.89%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8290.1%2.369.48s108,7790Direct2.391,367184,413108,76218.7%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.292.290.000.000.000.00000.0000249,110.48249,110.480.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.31%1.860791,367.0183,958120,19377,332.480117,978170,139170,1390.00%
crit18.69%0.4304184,413.34168,168232,07163,550.000232,07178,97278,9720.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71813.22
  • base_dd_max:71813.22
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.36s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.27
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.39s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.373.49s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1590.8172.1s0.5s277.7s99.94%100.00%581.1 (581.1)0.1

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.1s / 341.5s
  • trigger_min/max:0.0s / 4.8s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 360.0s
  • uptime_min/max:98.95% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.24%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.15%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.33%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.6117.1s3.5s126.9s97.36%0.00%74.2 (77.0)1.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 334.6s
  • trigger_min/max:1.0s / 41.6s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 357.8s
  • uptime_min/max:86.61% / 99.44%

Stack Uptimes

  • alacrity_1:3.04%
  • alacrity_2:2.14%
  • alacrity_3:1.83%
  • alacrity_4:1.69%
  • alacrity_5:88.65%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.05%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 58.0s
  • trigger_min/max:9.2s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.11% / 40.81%

Stack Uptimes

  • bolstering_shadows_1:37.05%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:84.8s / 181.2s
  • trigger_min/max:84.8s / 181.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.09%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0127.0s108.1s4.4s1.80%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 297.6s
  • trigger_min/max:90.0s / 188.9s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 10.3s
  • uptime_min/max:0.00% / 8.35%

Stack Uptimes

  • cryptic_instructions_1:1.80%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.923.1s23.1s8.2s36.43%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 72.2s
  • trigger_min/max:8.0s / 72.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.49% / 39.48%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.56%
  • danse_macabre_4:16.60%
  • danse_macabre_5:8.69%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.240.9s3.7s35.6s90.00%95.67%74.2 (74.2)6.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 177.0s
  • trigger_min/max:1.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 160.9s
  • uptime_min/max:80.27% / 95.73%

Stack Uptimes

  • deeper_daggers_1:90.00%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.37%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 58.0s
  • trigger_min/max:9.2s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.17% / 21.35%

Stack Uptimes

  • disorienting_strikes_1:12.19%
  • disorienting_strikes_2:6.18%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0129.9s109.9s4.1s1.66%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.4s
  • trigger_min/max:90.0s / 189.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 10.6s
  • uptime_min/max:0.00% / 7.58%

Stack Uptimes

  • errant_manaforge_emission_1:1.66%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.143.922.1s5.2s17.4s81.68%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 60.8s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.5s
  • uptime_min/max:64.01% / 92.97%

Stack Uptimes

  • escalating_blade_1:24.91%
  • escalating_blade_2:22.19%
  • escalating_blade_3:22.49%
  • escalating_blade_4:12.08%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.7s18.22%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:82.9s / 181.6s
  • trigger_min/max:82.9s / 181.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:12.99% / 20.79%

Stack Uptimes

  • ethereal_powerlink_1:18.22%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.284.4s72.7s15.4s10.77%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4399.55

Trigger Details

  • interval_min/max:15.1s / 304.7s
  • trigger_min/max:0.9s / 304.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 47.4s
  • uptime_min/max:0.00% / 37.43%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.77%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.68%0.00%14.3 (96.5)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.3s
  • trigger_min/max:1.0s / 87.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.94% / 16.89%

Stack Uptimes

  • flagellation_buff_1:1.31%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.44%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.84%
  • flagellation_buff_26:0.36%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.12%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.9s14.25%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.1s / 98.3s
  • trigger_min/max:78.1s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.27% / 16.27%

Stack Uptimes

  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.25%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6111.1s75.6s35.9s25.16%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:32.3s / 332.5s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 68.99%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.16%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6113.4s77.0s35.5s24.61%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 337.2s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 68.02%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.61%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6113.6s77.8s35.0s24.68%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 339.2s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 70.85%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.68%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.20.6112.6s76.8s35.4s25.55%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.9s / 359.4s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 156.4s
  • uptime_min/max:0.00% / 77.02%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.55%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.20.039.9s3.4s59.6s95.33%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.55%
  • flawless_form_2:8.86%
  • flawless_form_3:11.93%
  • flawless_form_4:9.68%
  • flawless_form_5:2.68%
  • flawless_form_6:4.53%
  • flawless_form_7:5.83%
  • flawless_form_8:11.24%
  • flawless_form_9:18.52%
  • flawless_form_10:8.72%
  • flawless_form_11:1.41%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.18%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.284.2s71.8s17.1s11.05%0.00%0.2 (0.2)1.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.2s / 294.5s
  • trigger_min/max:0.1s / 294.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 55.3s
  • uptime_min/max:0.00% / 36.25%

Stack Uptimes

  • nascent_empowerment_Crit_1:11.06%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.293.3s77.4s17.0s10.66%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.6s / 316.7s
  • trigger_min/max:0.3s / 316.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 54.2s
  • uptime_min/max:0.00% / 42.27%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.66%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.285.7s72.4s16.8s10.47%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.4s / 349.5s
  • trigger_min/max:0.4s / 349.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.9s
  • uptime_min/max:0.00% / 42.44%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.47%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.285.6s72.7s17.0s10.66%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.9s / 310.2s
  • trigger_min/max:0.3s / 310.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 53.7s
  • uptime_min/max:0.00% / 40.98%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.66%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.6s16.87%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 83.8s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.8s
  • uptime_min/max:9.17% / 27.04%

Stack Uptimes

  • poised_shadows_1:16.87%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.62%11.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.2s
  • trigger_min/max:1.0s / 66.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.3s
  • uptime_min/max:0.92% / 4.68%

Stack Uptimes

  • premeditation_1:2.62%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.30.0132.0s113.8s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.8s
  • trigger_min/max:90.0s / 189.6s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 10.5s
  • uptime_min/max:0.00% / 6.38%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.68%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.00.283.1s71.5s15.3s10.27%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:24882.36

Trigger Details

  • interval_min/max:15.0s / 312.7s
  • trigger_min/max:0.3s / 312.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.9s
  • uptime_min/max:0.00% / 39.64%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.27%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.9s90.9s15.8s19.22%17.16%0.0 (0.0)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.7s
  • trigger_min/max:90.0s / 98.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.82% / 21.88%

Stack Uptimes

  • shadow_blades_1:19.22%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.43%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 72.2s
  • trigger_min/max:8.0s / 72.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.49% / 39.48%

Stack Uptimes

  • shadow_dance_1:36.43%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.2138.14.4s1.5s3.5s79.10%95.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 46.5s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.6s
  • uptime_min/max:69.84% / 86.09%

Stack Uptimes

  • shadow_techniques_1:20.48%
  • shadow_techniques_2:20.96%
  • shadow_techniques_3:9.41%
  • shadow_techniques_4:10.48%
  • shadow_techniques_5:6.08%
  • shadow_techniques_6:5.79%
  • shadow_techniques_7:2.59%
  • shadow_techniques_8:2.29%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.8s99.32%87.62%98.8 (98.8)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 358.0s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.60.0111.9s102.8s9.9s1.93%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.2s / 282.9s
  • trigger_min/max:2.0s / 282.9s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 24.0s
  • uptime_min/max:0.00% / 13.20%

Stack Uptimes

  • storm_sewers_citrine_1:1.93%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0100.0s92.2s9.9s1.83%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 306.4s
  • trigger_min/max:1.0s / 306.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 19.2s
  • uptime_min/max:0.00% / 14.38%

Stack Uptimes

  • storm_sewers_citrine_1:1.83%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.098.1s94.8s9.9s1.99%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:1.0s / 275.5s
  • trigger_min/max:1.0s / 275.5s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 19.2s
  • uptime_min/max:0.00% / 14.28%

Stack Uptimes

  • storm_sewers_citrine_1:1.99%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.283.9s71.3s15.5s10.86%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1430.02
  • stat:haste_rating
  • amount:1430.02
  • stat:mastery_rating
  • amount:1430.02
  • stat:versatility_rating
  • amount:1430.02

Trigger Details

  • interval_min/max:15.2s / 315.1s
  • trigger_min/max:0.9s / 315.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.3s
  • uptime_min/max:0.00% / 39.68%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.86%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.3s21.3s2.3s10.96%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 65.7s
  • trigger_min/max:3.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.3s
  • uptime_min/max:8.99% / 14.84%

Stack Uptimes

  • supercharge_1_1:10.96%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.01%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.7s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.1s
  • uptime_min/max:0.35% / 5.77%

Stack Uptimes

  • supercharge_2_1:2.01%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.8s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 3.1s
  • uptime_min/max:0.00% / 1.06%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.5s21.3s24.5s61.12%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 97.7s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:56.48% / 65.45%

Stack Uptimes

  • symbols_of_death_1:61.12%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.2s307.2s27.2s13.33%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.8s
  • trigger_min/max:300.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.95% / 18.10%

Stack Uptimes

  • tempered_potion_1:13.33%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.3s21.3s2.9s13.77%22.26%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:4.0s / 65.7s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.4s
  • uptime_min/max:11.47% / 16.88%

Stack Uptimes

  • the_rotten_1:10.71%
  • the_rotten_2:3.06%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 137.7s
  • trigger_min/max:120.0s / 137.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.083.6s31.8s14.6s0.51%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4785.98

Trigger Details

  • interval_min/max:16.5s / 216.8s
  • trigger_min/max:3.1s / 216.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.3s
  • uptime_min/max:0.00% / 11.85%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.54%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.284.5s73.1s15.2s10.16%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5499.44

Trigger Details

  • interval_min/max:15.1s / 317.3s
  • trigger_min/max:0.3s / 317.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 60.6s
  • uptime_min/max:0.00% / 42.05%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.16%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.526.077.06.0s0.7s60.3s
Skyfury (Off Hand)49.420.079.06.0s0.7s68.2s
Supercharger secret_technique12.58.016.023.6s9.2s91.0s
Cold Blood secret_technique3.63.04.090.7s84.8s181.2s
Supercharger rupture0.30.02.0184.1s45.1s300.8s
Supercharger coup_de_grace2.70.08.078.3s9.2s319.4s
Supercharger eviscerate12.96.019.023.2s1.0s148.7s
CP Spent During Flagellation202.6145.0246.011.2s1.0s88.9s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.36%5.93%13.49%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Messerknecht
Energy RegenEnergy1,435.913,035.6034.13%2.11397.2411.57%
Improved AmbushCombo Points52.2933.444.57%0.6418.8636.06%
PremeditationCombo Points17.2156.857.78%3.3063.6252.81%
Relentless StrikesEnergy107.304,270.9248.02%39.80122.352.79%
Shadow BladesCombo Points21.94113.9315.58%5.1917.7213.46%
Shadow TechniquesEnergy359.071,233.1713.86%3.43203.0914.14%
Shadow TechniquesCombo Points85.52240.5532.90%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.25106.7714.60%7.000.000.00%
BackstabCombo Points75.4175.0110.26%0.990.400.54%
ShadowstrikeCombo Points52.29104.5614.30%2.000.020.02%
Symbols of DeathEnergy14.26355.073.99%24.89215.5137.77%
Usage Type Count Total Tot% Avg RPE APR
Messerknecht
BackstabEnergy75.413,016.5333.71%40.0040.003,004.87
Coup de GraceEnergy13.25463.835.18%35.0034.9982,045.40
Coup de GraceCombo Points13.2590.5112.45%6.836.83420,461.12
EviscerateEnergy68.482,396.8926.78%35.0035.0045,754.87
EviscerateCombo Points68.48466.6364.17%6.816.81235,024.59
RuptureEnergy9.55238.872.67%25.0025.00146,705.47
RuptureCombo Points9.5565.318.98%6.836.83536,599.14
Secret TechniqueEnergy16.01480.395.37%30.0030.00169,407.44
Secret TechniqueCombo Points16.01104.7114.40%6.546.54777,220.31
ShadowstrikeEnergy52.292,353.2526.29%45.0044.9914,976.29
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6729.86937.945.00.1100.0
Combo Points0.02.442.43100.53.90.07.0

Statistics & Data Analysis

Fight Length
Messerknecht Fight Length
Count 1217
Mean 299.79
Minimum 240.00
Maximum 359.97
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Messerknecht Damage Per Second
Count 1217
Mean 1464262.81
Minimum 1310784.98
Maximum 1613656.33
Spread ( max - min ) 302871.35
Range [ ( max - min ) / 2 * 100% ] 10.34%
Standard Deviation 50855.4506
5th Percentile 1381379.46
95th Percentile 1551368.64
( 95th Percentile - 5th Percentile ) 169989.18
Mean Distribution
Standard Deviation 1457.7808
95.00% Confidence Interval ( 1461405.61 - 1467120.01 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4634
0.1 Scale Factor Error with Delta=300 22077947
0.05 Scale Factor Error with Delta=300 88311787
0.01 Scale Factor Error with Delta=300 2207794674
Priority Target DPS
Messerknecht Priority Target Damage Per Second
Count 1217
Mean 1464262.81
Minimum 1310784.98
Maximum 1613656.33
Spread ( max - min ) 302871.35
Range [ ( max - min ) / 2 * 100% ] 10.34%
Standard Deviation 50855.4506
5th Percentile 1381379.46
95th Percentile 1551368.64
( 95th Percentile - 5th Percentile ) 169989.18
Mean Distribution
Standard Deviation 1457.7808
95.00% Confidence Interval ( 1461405.61 - 1467120.01 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4634
0.1 Scale Factor Error with Delta=300 22077947
0.05 Scale Factor Error with Delta=300 88311787
0.01 Scale Factor Error with Delta=300 2207794674
DPS(e)
Messerknecht Damage Per Second (Effective)
Count 1217
Mean 1464262.81
Minimum 1310784.98
Maximum 1613656.33
Spread ( max - min ) 302871.35
Range [ ( max - min ) / 2 * 100% ] 10.34%
Damage
Messerknecht Damage
Count 1217
Mean 438540469.57
Minimum 338631568.17
Maximum 536359215.16
Spread ( max - min ) 197727646.99
Range [ ( max - min ) / 2 * 100% ] 22.54%
DTPS
Messerknecht Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Messerknecht Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Messerknecht Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Messerknecht Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Messerknecht Healing Taken Per Second
Count 1217
Mean 2949.15
Minimum 0.00
Maximum 12071.55
Spread ( max - min ) 12071.55
Range [ ( max - min ) / 2 * 100% ] 204.66%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.29 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.41 backstab
actions.cds
# count action,conditions
F 3.58 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.27 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.01 secret_technique,if=variable.secret
L 9.55 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.25 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.48 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.30 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDMDNHNDFKNENENNEEENHQDNDKDMDNELEENEEMHQDKDNDNDNENELHQDMDKDNDNEENENEENEEEMEEOEJHQPKDNDINDMNELEQFKNHDNNDNDNENENEENEELRDNEHQKDMDNDNDNEEMEKEEENEEELEEEMEEENEOEJHQPKDNDINDNDLNHQDNDFKDMNDNNENHQDNDKDNDDMENEEELEEMEEHQKDNDNDNDENNEENRDKQDMDNHD

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, cryptic_instructions
0:01.006Gpotion
[cds]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, cryptic_instructions
0:01.006Jflagellation
[cds]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, cryptic_instructions, tempered_potion
0:02.011Neviscerate
[finish]
Fluffy_Pillow 87.8/100 88% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, cryptic_instructions, tempered_potion
0:03.016Rvanish
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:03.016Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:04.022Lrupture
[finish]
Fluffy_Pillow 69.8/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:05.025Hsymbols_of_death
[cds]
Messerknecht 98.2/100 98% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:05.025Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:05.025Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:05.025Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.031Ishadow_blades
[cds]
Messerknecht 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.031Ksecret_technique
[finish]
Fluffy_Pillow 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:07.036Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(3), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:08.042Neviscerate
[finish]
Fluffy_Pillow 78.0/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(4), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:09.050Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(4), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:10.056Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:11.060Mcoup_de_grace
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:12.264Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:13.269Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(10), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.273Hsymbols_of_death
[cds]
Messerknecht 92.2/100 92% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.273Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:15.276Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.280Fcold_blood
[cds]
Messerknecht 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.280Ksecret_technique
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.284Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.286Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:19.290Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.294Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.298Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.302Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.308Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:24.313Ebackstab
[build]
Fluffy_Pillow 74.6/100 75% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.317Ebackstab
[build]
Fluffy_Pillow 57.2/100 57% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.322Neviscerate
[finish]
Fluffy_Pillow 39.8/100 40% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion, storm_sewers_citrine
0:27.326Hsymbols_of_death
[cds]
Messerknecht 54.4/100 54% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion, storm_sewers_citrine
0:27.326Qshadow_dance
[stealth_cds]
Messerknecht 94.4/100 94% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion, storm_sewers_citrine
0:27.326Dshadowstrike
[build]
Fluffy_Pillow 94.4/100 94% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion, storm_sewers_citrine
0:28.329Neviscerate
[finish]
Fluffy_Pillow 63.9/100 64% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion, storm_sewers_citrine
0:29.334Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion, storm_sewers_citrine
0:30.338Ksecret_technique
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, tempered_potion, storm_sewers_citrine
0:31.341Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(7), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
0:32.347Mcoup_de_grace
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
0:33.553Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
0:34.559Neviscerate
[finish]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:35.564Ebackstab
[build]
Fluffy_Pillow 91.1/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:36.567Lrupture
[finish]
Fluffy_Pillow 73.1/100 73% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:37.571Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:38.576Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_vers
0:39.581Neviscerate
[finish]
Fluffy_Pillow 56.1/100 56% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:40.586Ebackstab
[build]
Fluffy_Pillow 71.2/100 71% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:41.590Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_vers
0:43.206Mcoup_de_grace
[finish]
Fluffy_Pillow 35.4/100 35% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:44.410Hsymbols_of_death
[cds]
Messerknecht 76.3/100 76% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:44.410Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:44.410Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:45.414Ksecret_technique
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:46.418Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:47.421Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(11), shadow_techniques(6), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:48.425Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(11), shadow_techniques(8), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:49.429Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(12), shadow_techniques(6), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:50.434Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(8), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:51.439Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(6), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:52.443Ebackstab
[build]
Fluffy_Pillow 85.2/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(8), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:53.447Neviscerate
[finish]
Fluffy_Pillow 64.0/100 64% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:54.451Ebackstab
[build]
Fluffy_Pillow 82.8/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:55.456Lrupture
[finish]
Fluffy_Pillow 53.6/100 54% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:56.462Hsymbols_of_death
[cds]
Messerknecht 82.4/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:56.462Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:56.462Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:57.466Mcoup_de_grace
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:58.671Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
0:59.675Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:00.681Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:01.687Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:02.693Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:03.697Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:04.702Ebackstab
[build]
Fluffy_Pillow 77.2/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:05.706Ebackstab
[build]
Fluffy_Pillow 64.0/100 64% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:06.830Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:07.835Ebackstab
[build]
Fluffy_Pillow 54.9/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(5), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:09.087Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:10.089Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:12.967Ebackstab
[build]
Fluffy_Pillow 45.0/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
1:15.656Neviscerate
[finish]
Fluffy_Pillow 37.9/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
1:16.659Ebackstab
[build]
Fluffy_Pillow 48.7/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
1:19.227Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
1:22.461Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:25.156Mcoup_de_grace
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, flask_of_alchemical_chaos_crit
1:26.361Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
1:27.366Ebackstab
[build]
Fluffy_Pillow 48.8/100 49% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
1:29.759Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 39.0/100 39% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:30.000Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:31.005Jflagellation
[cds]
Fluffy_Pillow 16.7/100 17% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.011Hsymbols_of_death
[cds]
Messerknecht 27.7/100 28% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, flagellation_buff, deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.011Qshadow_dance
[stealth_cds]
Messerknecht 67.7/100 68% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.011Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.7/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.011Ksecret_technique
[finish]
Fluffy_Pillow 67.7/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:33.016Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(7), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:34.020Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:35.024Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:36.027Ishadow_blades
[cds]
Messerknecht 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(3), flagellation_buff(20), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:36.031Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(3), flagellation_buff(20), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:37.037Dshadowstrike
[build]
Fluffy_Pillow 93.1/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), flagellation_buff(27), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:38.042Mcoup_de_grace
[finish]
Fluffy_Pillow 67.1/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(7), flagellation_buff(27), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:39.246Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:40.251Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:41.258Lrupture
[finish]
Fluffy_Pillow 71.0/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:42.263Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:43.269Qshadow_dance
[stealth_cds]
Messerknecht 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(10), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:43.269Fcold_blood
[cds]
Messerknecht 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(10), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:43.269Ksecret_technique
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(9), premeditation, shadow_techniques(10), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:44.272Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:45.279Hsymbols_of_death
[cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), premeditation, shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:45.279Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:46.284Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:47.286Neviscerate
[finish]
Fluffy_Pillow 99.6/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:48.294Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:49.298Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:50.302Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:51.305Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:52.309Ebackstab
[build]
Fluffy_Pillow 77.1/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:53.313Neviscerate
[finish]
Fluffy_Pillow 55.9/100 56% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:54.316Ebackstab
[build]
Fluffy_Pillow 74.7/100 75% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:55.319Neviscerate
[finish]
Fluffy_Pillow 45.5/100 45% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:56.323Ebackstab
[build]
Fluffy_Pillow 64.3/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:57.747Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:59.319Neviscerate
[finish]
Fluffy_Pillow 36.5/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:00.325Ebackstab
[build]
Fluffy_Pillow 46.3/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:02.785Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
2:05.057Lrupture
[finish]
Fluffy_Pillow 29.6/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:06.063Rvanish
[stealth_cds]
Messerknecht 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:06.063Dshadowstrike
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
2:07.974Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(4), poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:08.978Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(5), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:09.982Hsymbols_of_death
[cds]
Messerknecht 22.5/100 23% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:10.026Qshadow_dance
[stealth_cds]
Messerknecht 63.0/100 63% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), the_rotten(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:10.026Ksecret_technique
[finish]
Fluffy_Pillow 63.0/100 63% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), premeditation, the_rotten(2), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:11.028Dshadowstrike
[build]
Fluffy_Pillow 97.4/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:12.032Mcoup_de_grace
[finish]
Fluffy_Pillow 71.8/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:13.235Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:14.241Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:15.246Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:16.250Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:17.256Dshadowstrike
[build]
Fluffy_Pillow 87.7/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:18.262Neviscerate
[finish]
Fluffy_Pillow 62.1/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:19.267Ebackstab
[build]
Fluffy_Pillow 73.5/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:20.272Ebackstab
[build]
Fluffy_Pillow 52.9/100 53% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:21.391Mcoup_de_grace
[finish]
Fluffy_Pillow 41.6/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(11), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:22.596Ebackstab
[build]
Fluffy_Pillow 80.3/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(15), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:23.602Ksecret_technique
[finish]
Fluffy_Pillow 59.7/100 60% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(14), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:24.606Ebackstab
[build]
Fluffy_Pillow 71.1/100 71% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:25.610Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:28.323Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:31.062Neviscerate
[finish]
Fluffy_Pillow 36.5/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:32.064Ebackstab
[build]
Fluffy_Pillow 51.8/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:34.666Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
2:37.939Ebackstab
[build]
Fluffy_Pillow 44.5/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:39.519Lrupture
[finish]
Fluffy_Pillow 25.1/100 25% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form, shadow_techniques, flask_of_alchemical_chaos_mastery
2:40.523Ebackstab
[build]
Fluffy_Pillow 45.5/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), shadow_techniques, flask_of_alchemical_chaos_mastery
2:43.579Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), shadow_techniques, flask_of_alchemical_chaos_mastery
2:46.563Ebackstab
[build]
Fluffy_Pillow 44.2/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_mastery
2:49.278Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_mastery
2:50.483Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:51.488Ebackstab
[build]
Fluffy_Pillow 48.6/100 49% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:54.105Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:56.695Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:57.700Ebackstab
[build]
Fluffy_Pillow 45.8/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:00.105Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 35.3/100 35% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
3:00.522Ebackstab
[build]
Fluffy_Pillow 43.7/100 44% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), flawless_form(5), shadow_techniques(2), deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:01.525Jflagellation
[cds]
Fluffy_Pillow 18.3/100 18% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), shadow_techniques, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:02.529Hsymbols_of_death
[cds]
Messerknecht 28.9/100 29% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), shadow_techniques, flagellation_buff, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:02.529Qshadow_dance
[stealth_cds]
Messerknecht 68.9/100 69% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:02.529Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.9/100 69% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:02.529Ksecret_technique
[finish]
Fluffy_Pillow 68.9/100 69% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:03.533Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes(2), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:04.537Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:05.541Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:06.545Ishadow_blades
[cds]
Messerknecht 65.4/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:06.545Neviscerate
[finish]
Fluffy_Pillow 65.4/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:07.550Dshadowstrike
[build]
Fluffy_Pillow 84.3/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:08.555Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:09.559Dshadowstrike
[build]
Fluffy_Pillow 76.9/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:10.564Lrupture
[finish]
Fluffy_Pillow 50.8/100 51% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(9), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:11.568Neviscerate
[finish]
Fluffy_Pillow 79.6/100 80% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:12.572Hsymbols_of_death
[cds]
Messerknecht 90.5/100 90% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:12.572Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:12.572Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:13.575Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:14.579Dshadowstrike
[build]
Fluffy_Pillow 99.7/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:15.584Fcold_blood
[cds]
Messerknecht 65.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:15.584Ksecret_technique
[finish]
Fluffy_Pillow 65.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:16.588Dshadowstrike
[build]
Fluffy_Pillow 96.3/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.593Mcoup_de_grace
[finish]
Fluffy_Pillow 78.2/100 78% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:18.797Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:19.801Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:20.804Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:21.808Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:22.813Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:23.816Neviscerate
[finish]
Fluffy_Pillow 71.0/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:24.821Hsymbols_of_death
[cds]
Messerknecht 90.1/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:25.026Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:25.026Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:26.031Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:27.036Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:28.042Ksecret_technique
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:29.045Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:30.048Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
3:31.054Dshadowstrike
[build]
Fluffy_Pillow 77.1/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
3:32.059Dshadowstrike
[build]
Fluffy_Pillow 51.2/100 51% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:34.075Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:35.282Ebackstab
[build]
Fluffy_Pillow 83.2/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:36.286Neviscerate
[finish]
Fluffy_Pillow 54.9/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:37.287Ebackstab
[build]
Fluffy_Pillow 66.5/100 66% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:38.290Ebackstab
[build]
Fluffy_Pillow 46.1/100 46% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:39.974Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:41.435Lrupture
[finish]
Fluffy_Pillow 26.5/100 27% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:42.441Ebackstab
[build]
Fluffy_Pillow 48.2/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:44.947Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(8), shadow_techniques, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:47.220Mcoup_de_grace
[finish]
Fluffy_Pillow 35.5/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:48.425Ebackstab
[build]
Fluffy_Pillow 74.5/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:49.430Ebackstab
[build]
Fluffy_Pillow 50.0/100 50% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:50.436Hsymbols_of_death
[cds]
Messerknecht 25.5/100 25% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:50.436Qshadow_dance
[stealth_cds]
Messerknecht 65.5/100 65% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:50.436Ksecret_technique
[finish]
Fluffy_Pillow 65.5/100 65% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:51.440Dshadowstrike
[build]
Fluffy_Pillow 86.9/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(8), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:52.446Neviscerate
[finish]
Fluffy_Pillow 61.3/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:53.451Dshadowstrike
[build]
Fluffy_Pillow 87.7/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:54.456Neviscerate
[finish]
Fluffy_Pillow 62.1/100 62% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:55.461Dshadowstrike
[build]
Fluffy_Pillow 76.5/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:56.466Neviscerate
[finish]
Fluffy_Pillow 50.9/100 51% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:57.471Dshadowstrike
[build]
Fluffy_Pillow 62.4/100 62% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:58.842Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
4:00.541Neviscerate
[finish]
Fluffy_Pillow 44.2/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(7), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:01.546Neviscerate
[finish]
Fluffy_Pillow 55.6/100 56% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:02.550Ebackstab
[build]
Fluffy_Pillow 75.0/100 75% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:03.555Ebackstab
[build]
Fluffy_Pillow 54.4/100 54% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:05.127Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:06.131Rvanish
[stealth_cds]
Messerknecht 46.7/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:06.131Dshadowstrike
[build]
Fluffy_Pillow 46.7/100 47% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, premeditation, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:08.402Ksecret_technique
[finish]
Fluffy_Pillow 31.5/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:09.408Qshadow_dance
[stealth_cds]
Messerknecht 47.9/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:09.408Dshadowstrike
[build]
Fluffy_Pillow 47.9/100 48% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:11.632Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:12.838Dshadowstrike
[build]
Fluffy_Pillow 74.9/100 75% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:13.841Neviscerate
[finish]
Fluffy_Pillow 45.3/100 45% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:14.845Hsymbols_of_death
[cds]
Messerknecht 56.7/100 57% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:15.026Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit22.02%16.97%3476
Haste2.35%2.79%1843
Versatility24.83%22.21%17321
Attack Power6162857457938
Mastery66.00%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Messerknecht"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385,crafted_stats=32/49
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460,crafted_stats=40/32

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 1229
Threads: 12
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.8 )

Performance:

Total Events Processed: 21127581
Max Event Queue: 552
Sim Seconds: 368436
CPU Seconds: 49.1562
Physical Seconds: 4.8500
Speed Up: 7495

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Combo 1 Combo 1 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 1 Combo 1 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.71sec 0 299.79sec
Combo 1 Combo 1 auto_attack_mh 0 14055466 46885 70.91 38394 77335 354.3 354.3 19.4% 16.4% 0.0% 0.0% 0.99sec 18337732 299.79sec
Combo 1 Combo 1 auto_attack_oh 1 7002111 23357 70.82 19122 38579 353.9 353.9 19.5% 16.3% 0.0% 0.0% 0.99sec 9135334 299.79sec
Combo 1 Combo 1 backstab 53 9089634 30320 15.11 72975 188837 75.5 75.5 40.9% 0.0% 0.0% 0.0% 3.68sec 11891847 299.79sec
Combo 1 Combo 1 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.58sec 0 299.79sec
Combo 1 Combo 1 coup_de_grace 441776 26821038 89467 7.96 519582 1049275 13.3 39.8 29.2% 0.0% 0.0% 0.0% 22.29sec 34920349 299.79sec
Combo 1 Combo 1 eviscerate_coup_de_grace_bonus 462244 11445003 38177 7.66 231131 464007 0.0 38.3 29.2% 0.0% 0.0% 0.0% 0.00sec 11445003 299.79sec
Combo 1 Combo 1 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.83sec 0 299.79sec
Combo 1 Combo 1 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 1 Combo 1 elemental_focusing_lens_onyx 461191 6014616 20063 4.46 269766 0 22.3 22.3 0.0% 0.0% 0.0% 0.0% 12.57sec 6014616 299.79sec
Combo 1 Combo 1 eviscerate 196819 76821240 256254 13.73 858882 1756878 68.6 68.6 29.1% 0.0% 0.0% 0.0% 4.35sec 99930799 299.79sec
Combo 1 Combo 1 eviscerate_bonus 328082 33090407 110380 13.48 377322 771251 67.3 67.3 29.0% 0.0% 0.0% 0.0% 4.42sec 33090407 299.79sec
Combo 1 Combo 1 flagellation 384631 307617 1026 0.74 69684 140851 3.7 3.7 18.5% 0.0% 0.0% 0.0% 91.28sec 307617 299.79sec
Combo 1 Combo 1 flagellation_damage 394757 5992998 19991 4.78 209623 420479 0.0 23.9 19.5% 0.0% 0.0% 0.0% 0.00sec 5992998 299.79sec
Combo 1 Combo 1 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 1 Combo 1 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 1 Combo 1 instant_poison 315585 3662789 12218 56.80 10798 21748 0.0 283.8 19.3% 0.0% 0.0% 0.0% 0.00sec 3662789 299.79sec
Combo 1 Combo 1 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.4 0.0 0.0% 0.0% 0.0% 0.0% 11.39sec 0 299.79sec
Combo 1 Combo 1 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 66.30sec 0 299.79sec
Combo 1 Combo 1 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 81.55sec 0 299.79sec
Combo 1 Combo 1 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.24sec 0 299.79sec
Combo 1 Combo 1 recuperator 426605 0 0 0.00 0 0 98.8 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.79sec
Combo 1 Combo 1 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 69.53sec 0 299.79sec
Combo 1 Combo 1 rupture ticks -1943 29658120 98860 33.45 135815 282737 9.5 167.2 28.3% 0.0% 0.0% 0.0% 31.31sec 29658120 299.79sec
Combo 1 Combo 1 rupture_replicating_shadows ticks -394031 5452751 18176 0.00 25015 51813 167.2 0.0 28.3% 0.0% 0.0% 0.0% 1.76sec 5452751 299.79sec
Combo 1 Combo 1 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.94sec 0 299.79sec
Combo 1 Combo 1 secret_technique_player 280720 20948181 69877 3.21 685905 2128918 0.0 16.0 43.1% 0.0% 0.0% 0.0% 0.00sec 27306698 299.79sec
Combo 1 Combo 1 secret_technique_clones 282449 60692371 202453 6.40 998986 3042924 0.0 32.0 44.1% 0.0% 0.0% 0.0% 0.00sec 60692371 299.79sec
Combo 1 Combo 1 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.81sec 0 299.79sec
Combo 1 Combo 1 shadow_blades_attack ticks -279043 31435677 104786 0.00 81512 0 385.7 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31435677 299.79sec
Combo 1 Combo 1 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.10sec 0 299.79sec
Combo 1 Combo 1 shadowstrike 185438 35188840 117380 10.45 280879 916471 52.2 52.2 61.9% 0.0% 0.0% 0.0% 5.83sec 45885086 299.79sec
Combo 1 Combo 1 squall_sailors_citrine 462952 1094862 3652 0.46 401106 802615 2.3 2.3 19.1% 0.0% 0.0% 0.0% 73.22sec 1094862 299.79sec
Combo 1 Combo 1 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 1 Combo 1 storm_sewers_citrine 462958 0 0 0.45 0 0 2.2 2.2 0.0% 0.0% 0.0% 0.0% 66.99sec 1543169 299.79sec
Combo 1 Combo 1 storm_sewers_citrine_damage 468422 247454 825 0.45 91428 184178 2.2 2.2 20.0% 0.0% 0.0% 0.0% 66.99sec 247454 299.79sec
Combo 1 Combo 1 suffocating_darkness ticks -449217 14084829 46949 21.44 131517 0 18.9 107.2 0.0% 0.0% 0.0% 0.0% 15.66sec 14084829 299.79sec
Combo 1 Combo 1 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.36sec 0 299.79sec
Combo 1 Combo 1 thunderlords_crackling_citrine 462951 19261314 64250 6.47 499159 999546 32.3 32.3 19.4% 0.0% 0.0% 0.0% 9.15sec 19261314 299.79sec
Combo 1 Combo 1 undersea_overseers_citrine 462953 1331133 4440 0.46 480837 963567 2.3 2.3 19.5% 0.0% 0.0% 0.0% 74.17sec 1331133 299.79sec
Combo 1 Combo 1 unseen_blade 441144 25601851 85401 11.65 367962 739044 58.2 58.2 19.3% 0.0% 0.0% 0.0% 5.15sec 33445876 299.79sec
Combo 1 Combo 1 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.71sec 0 299.79sec
Combo 1 Combo 1 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 67.70sec 0 299.79sec
Combo 2 Combo 2 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 2 Combo 2 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 299.79sec
Combo 2 Combo 2 auto_attack_mh 0 14383026 47978 70.97 38125 76765 354.6 354.6 22.4% 16.3% 0.0% 0.0% 0.98sec 18754120 299.79sec
Combo 2 Combo 2 auto_attack_oh 1 7142582 23826 70.82 18973 38309 353.9 353.9 22.4% 16.4% 0.0% 0.0% 0.98sec 9313605 299.79sec
Combo 2 Combo 2 backstab 53 9243380 30833 15.09 72431 186789 75.4 75.4 43.8% 0.0% 0.0% 0.0% 3.68sec 12081596 299.79sec
Combo 2 Combo 2 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.83sec 0 299.79sec
Combo 2 Combo 2 coup_de_grace 441776 26315351 87781 7.99 499490 996657 13.3 39.9 32.2% 0.0% 0.0% 0.0% 22.48sec 34253927 299.79sec
Combo 2 Combo 2 eviscerate_coup_de_grace_bonus 462244 11320049 37761 7.73 220604 443027 0.0 38.6 32.7% 0.0% 0.0% 0.0% 0.00sec 11320049 299.79sec
Combo 2 Combo 2 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.46sec 0 299.79sec
Combo 2 Combo 2 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 2 Combo 2 elemental_focusing_lens_onyx 461191 5980010 19948 4.47 267533 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.81sec 5980010 299.79sec
Combo 2 Combo 2 eviscerate 196819 75419624 251579 13.73 822124 1682793 68.6 68.6 32.2% 0.0% 0.0% 0.0% 4.38sec 98097708 299.79sec
Combo 2 Combo 2 eviscerate_bonus 328082 32479132 108341 13.52 360864 735656 67.5 67.5 32.0% 0.0% 0.0% 0.0% 4.46sec 32479132 299.79sec
Combo 2 Combo 2 flagellation 384631 312821 1043 0.74 69113 138569 3.7 3.7 21.8% 0.0% 0.0% 0.0% 91.42sec 312821 299.79sec
Combo 2 Combo 2 flagellation_damage 394757 6090473 20316 4.79 208312 413853 0.0 23.9 22.6% 0.0% 0.0% 0.0% 0.00sec 6090473 299.79sec
Combo 2 Combo 2 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 2 Combo 2 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 2 Combo 2 instant_poison 315585 3720334 12410 56.62 10709 21536 0.0 282.9 22.6% 0.0% 0.0% 0.0% 0.00sec 3720334 299.79sec
Combo 2 Combo 2 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.7 0.0 0.0% 0.0% 0.0% 0.0% 11.61sec 0 299.79sec
Combo 2 Combo 2 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 73.68sec 0 299.79sec
Combo 2 Combo 2 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 73.08sec 0 299.79sec
Combo 2 Combo 2 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.27sec 0 299.79sec
Combo 2 Combo 2 recuperator 426605 0 0 0.00 0 0 98.8 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.79sec
Combo 2 Combo 2 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 71.07sec 0 299.79sec
Combo 2 Combo 2 rupture ticks -1943 29024880 96750 33.45 129923 268690 9.5 167.3 31.4% 0.0% 0.0% 0.0% 31.26sec 29024880 299.79sec
Combo 2 Combo 2 rupture_replicating_shadows ticks -394031 5342457 17808 0.00 23871 49547 167.3 0.0 31.4% 0.0% 0.0% 0.0% 1.76sec 5342457 299.79sec
Combo 2 Combo 2 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.95sec 0 299.79sec
Combo 2 Combo 2 secret_technique_player 280720 20275742 67634 3.21 654359 2008441 0.0 16.0 45.1% 0.0% 0.0% 0.0% 0.00sec 26420735 299.79sec
Combo 2 Combo 2 secret_technique_clones 282449 58880347 196408 6.40 949197 2868089 0.0 32.0 46.5% 0.0% 0.0% 0.0% 0.00sec 58880347 299.79sec
Combo 2 Combo 2 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.01sec 0 299.79sec
Combo 2 Combo 2 shadow_blades_attack ticks -279043 31121571 103739 0.00 80677 0 385.7 0.0 0.0% 0.0% 0.0% 0.0% 1.21sec 31121571 299.79sec
Combo 2 Combo 2 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.14sec 0 299.79sec
Combo 2 Combo 2 shadowstrike 185438 35337232 117875 10.47 278484 903708 52.3 52.3 63.5% 0.0% 0.0% 0.0% 5.81sec 46062791 299.79sec
Combo 2 Combo 2 squall_sailors_citrine 462952 1084401 3617 0.45 389919 778444 2.3 2.3 22.7% 0.0% 0.0% 0.0% 76.45sec 1084401 299.79sec
Combo 2 Combo 2 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 2 Combo 2 storm_sewers_citrine 462958 0 0 0.47 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 75.85sec 1561647 299.79sec
Combo 2 Combo 2 storm_sewers_citrine_damage 468422 252731 843 0.47 88265 176497 2.3 2.3 22.2% 0.0% 0.0% 0.0% 75.85sec 252731 299.79sec
Combo 2 Combo 2 suffocating_darkness ticks -449217 14015415 46718 21.49 130423 0 19.0 107.4 0.0% 0.0% 0.0% 0.0% 15.06sec 14015415 299.79sec
Combo 2 Combo 2 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.36sec 0 299.79sec
Combo 2 Combo 2 thunderlords_crackling_citrine 462951 19265033 64263 6.50 485141 973787 32.5 32.5 22.2% 0.0% 0.0% 0.0% 9.10sec 19265033 299.79sec
Combo 2 Combo 2 undersea_overseers_citrine 462953 1387805 4629 0.48 467400 937619 2.4 2.4 22.8% 0.0% 0.0% 0.0% 73.66sec 1387805 299.79sec
Combo 2 Combo 2 unseen_blade 441144 26060634 86931 11.66 364791 734755 58.2 58.2 22.3% 0.0% 0.0% 0.0% 5.20sec 34025195 299.79sec
Combo 2 Combo 2 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 299.79sec
Combo 2 Combo 2 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 72.63sec 0 299.79sec
Combo 3 Combo 3 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 3 Combo 3 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.02sec 0 299.79sec
Combo 3 Combo 3 auto_attack_mh 0 14857203 49559 70.79 39563 79634 353.7 353.7 22.2% 16.3% 0.0% 0.0% 0.98sec 19373240 299.79sec
Combo 3 Combo 3 auto_attack_oh 1 7405629 24703 70.63 19723 39671 352.9 352.9 22.4% 16.2% 0.0% 0.0% 0.99sec 9656851 299.79sec
Combo 3 Combo 3 backstab 53 9601575 32028 15.07 75241 194013 75.3 75.3 44.0% 0.0% 0.0% 0.0% 3.71sec 12550860 299.79sec
Combo 3 Combo 3 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.68sec 0 299.79sec
Combo 3 Combo 3 coup_de_grace 441776 26992924 90041 7.97 510858 1025297 13.3 39.8 32.4% 0.0% 0.0% 0.0% 22.33sec 35137553 299.79sec
Combo 3 Combo 3 eviscerate_coup_de_grace_bonus 462244 11536665 38483 7.70 225795 456387 0.0 38.5 32.1% 0.0% 0.0% 0.0% 0.00sec 11536665 299.79sec
Combo 3 Combo 3 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.57sec 0 299.79sec
Combo 3 Combo 3 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 3 Combo 3 elemental_focusing_lens_onyx 461191 6168594 20577 4.44 277851 0 22.2 22.2 0.0% 0.0% 0.0% 0.0% 12.85sec 6168594 299.79sec
Combo 3 Combo 3 eviscerate 196819 77118248 257245 13.71 847113 1725812 68.5 68.5 31.7% 0.0% 0.0% 0.0% 4.38sec 100305843 299.79sec
Combo 3 Combo 3 eviscerate_bonus 328082 33292294 111054 13.50 371615 755028 67.4 67.4 31.9% 0.0% 0.0% 0.0% 4.44sec 33292294 299.79sec
Combo 3 Combo 3 flagellation 384631 327489 1092 0.74 72015 144408 3.7 3.7 22.4% 0.0% 0.0% 0.0% 91.36sec 327489 299.79sec
Combo 3 Combo 3 flagellation_damage 394757 6346867 21171 4.78 216345 430786 0.0 23.9 23.0% 0.0% 0.0% 0.0% 0.00sec 6346867 299.79sec
Combo 3 Combo 3 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 3 Combo 3 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 3 Combo 3 instant_poison 315585 3850522 12844 56.62 11106 22387 0.0 282.9 22.2% 0.0% 0.0% 0.0% 0.00sec 3850522 299.79sec
Combo 3 Combo 3 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.25sec 0 299.79sec
Combo 3 Combo 3 recuperator 426605 0 0 0.00 0 0 98.8 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.79sec
Combo 3 Combo 3 rupture ticks -1943 29650335 98834 33.35 133206 275954 9.5 166.8 31.3% 0.0% 0.0% 0.0% 31.38sec 29650335 299.79sec
Combo 3 Combo 3 rupture_replicating_shadows ticks -394031 5449603 18165 0.00 24518 50684 166.8 0.0 31.2% 0.0% 0.0% 0.0% 1.76sec 5449603 299.79sec
Combo 3 Combo 3 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.87sec 0 299.79sec
Combo 3 Combo 3 secret_technique_player 280720 20906444 69738 3.21 671576 2050603 0.0 16.0 45.9% 0.0% 0.0% 0.0% 0.00sec 27242468 299.79sec
Combo 3 Combo 3 secret_technique_clones 282449 60402744 201487 6.39 975522 2944265 0.0 31.9 46.5% 0.0% 0.0% 0.0% 0.00sec 60402744 299.79sec
Combo 3 Combo 3 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.96sec 0 299.79sec
Combo 3 Combo 3 shadow_blades_attack ticks -279043 32070975 106903 0.00 83289 0 385.1 0.0 0.0% 0.0% 0.0% 0.0% 1.21sec 32070975 299.79sec
Combo 3 Combo 3 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.16sec 0 299.79sec
Combo 3 Combo 3 shadowstrike 185438 36579977 122021 10.45 289471 938800 52.2 52.2 63.4% 0.0% 0.0% 0.0% 5.81sec 47679958 299.79sec
Combo 3 Combo 3 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Combo 3 Combo 3 suffocating_darkness ticks -449217 14555309 48518 21.50 135285 0 19.1 107.5 0.0% 0.0% 0.0% 0.0% 15.23sec 14555309 299.79sec
Combo 3 Combo 3 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.35sec 0 299.79sec
Combo 3 Combo 3 unseen_blade 441144 26901621 89736 11.62 378811 762294 58.1 58.1 22.0% 0.0% 0.0% 0.0% 5.13sec 35124465 299.79sec
Combo 3 Combo 3 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.02sec 0 299.79sec
Messerknecht Messerknecht augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Messerknecht Messerknecht auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.39sec 0 299.79sec
Messerknecht Messerknecht auto_attack_mh 0 14018274 46761 70.94 38395 77330 354.4 354.4 19.2% 16.5% 0.0% 0.0% 0.98sec 18291726 299.79sec
Messerknecht Messerknecht auto_attack_oh 1 6993020 23327 70.81 19126 38565 353.8 353.8 19.4% 16.4% 0.0% 0.0% 0.98sec 9124839 299.79sec
Messerknecht Messerknecht backstab 53 9064297 30236 15.09 72926 188721 75.4 75.4 40.8% 0.0% 0.0% 0.0% 3.69sec 11860980 299.79sec
Messerknecht Messerknecht cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.77sec 0 299.79sec
Messerknecht Messerknecht coup_de_grace 441776 26669267 88961 7.95 518300 1040797 13.3 39.7 29.3% 0.0% 0.0% 0.0% 22.60sec 34723454 299.79sec
Messerknecht Messerknecht eviscerate_coup_de_grace_bonus 462244 11385715 37980 7.64 230071 463644 0.0 38.2 29.2% 0.0% 0.0% 0.0% 0.00sec 11385715 299.79sec
Messerknecht Messerknecht cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.20sec 0 299.79sec
Messerknecht Messerknecht elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Messerknecht Messerknecht elemental_focusing_lens_onyx 461191 6047143 20172 4.49 269705 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.91sec 6047143 299.79sec
Messerknecht Messerknecht eviscerate 196819 76603487 255528 13.71 859133 1755561 68.5 68.5 29.0% 0.0% 0.0% 0.0% 4.37sec 99651815 299.79sec
Messerknecht Messerknecht eviscerate_bonus 328082 33065796 110298 13.44 376595 775192 67.2 67.2 29.1% 0.0% 0.0% 0.0% 4.46sec 33065796 299.79sec
Messerknecht Messerknecht flagellation 384631 309488 1032 0.74 69868 140006 3.7 3.7 19.2% 0.0% 0.0% 0.0% 91.45sec 309488 299.79sec
Messerknecht Messerknecht flagellation_damage 394757 5996657 20003 4.78 209797 418894 0.0 23.9 19.7% 0.0% 0.0% 0.0% 0.00sec 5996657 299.79sec
Messerknecht Messerknecht flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Messerknecht Messerknecht food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Messerknecht Messerknecht instant_poison 315585 3650631 12177 56.57 10792 21744 0.0 282.6 19.4% 0.0% 0.0% 0.0% 0.00sec 3650631 299.79sec
Messerknecht Messerknecht legendary_skippers_citrine 462962 0 0 0.00 0 0 25.5 0.0 0.0% 0.0% 0.0% 0.0% 11.47sec 0 299.79sec
Messerknecht Messerknecht mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 77.89sec 0 299.79sec
Messerknecht Messerknecht old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 66.24sec 0 299.79sec
Messerknecht Messerknecht potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.22sec 0 299.79sec
Messerknecht Messerknecht recuperator 426605 0 0 0.00 0 0 98.8 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.79sec
Messerknecht Messerknecht roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 61.14sec 0 299.79sec
Messerknecht Messerknecht rupture ticks -1943 29597534 98658 33.46 135604 282013 9.6 167.3 28.2% 0.0% 0.0% 0.0% 31.27sec 29597534 299.79sec
Messerknecht Messerknecht rupture_replicating_shadows ticks -394031 5446450 18155 0.00 24983 51658 167.3 0.0 28.4% 0.0% 0.0% 0.0% 1.76sec 5446450 299.79sec
Messerknecht Messerknecht secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.96sec 0 299.79sec
Messerknecht Messerknecht secret_technique_player 280720 20876295 69637 3.21 687372 2112805 0.0 16.0 43.2% 0.0% 0.0% 0.0% 0.00sec 27215967 299.79sec
Messerknecht Messerknecht secret_technique_clones 282449 60505438 201829 6.39 994077 3040225 0.0 31.9 44.0% 0.0% 0.0% 0.0% 0.00sec 60505438 299.79sec
Messerknecht Messerknecht shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.94sec 0 299.79sec
Messerknecht Messerknecht shadow_blades_attack ticks -279043 31376406 104588 0.00 81540 0 384.9 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31376406 299.79sec
Messerknecht Messerknecht shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.19sec 0 299.79sec
Messerknecht Messerknecht shadowstrike 185438 35243026 117561 10.47 280609 916065 52.3 52.3 61.9% 0.0% 0.0% 0.0% 5.83sec 45956684 299.79sec
Messerknecht Messerknecht squall_sailors_citrine 462952 1134201 3783 0.47 400873 803998 2.4 2.4 19.7% 0.0% 0.0% 0.0% 76.04sec 1134201 299.79sec
Messerknecht Messerknecht stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
Messerknecht Messerknecht storm_sewers_citrine 462958 0 0 0.46 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 69.48sec 1570705 299.79sec
Messerknecht Messerknecht storm_sewers_citrine_damage 468422 249110 831 0.46 91367 184413 2.3 2.3 18.7% 0.0% 0.0% 0.0% 69.48sec 249110 299.79sec
Messerknecht Messerknecht suffocating_darkness ticks -449217 14236396 47455 21.45 132710 0 19.2 107.2 0.0% 0.0% 0.0% 0.0% 15.44sec 14236396 299.79sec
Messerknecht Messerknecht symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.36sec 0 299.79sec
Messerknecht Messerknecht thunderlords_crackling_citrine 462951 19223548 64124 6.45 499259 1001919 32.3 32.3 19.3% 0.0% 0.0% 0.0% 9.20sec 19223548 299.79sec
Messerknecht Messerknecht undersea_overseers_citrine 462953 1334478 4451 0.47 481349 968095 2.3 2.3 18.9% 0.0% 0.0% 0.0% 70.59sec 1334478 299.79sec
Messerknecht Messerknecht unseen_blade 441144 25513811 85107 11.60 367853 740492 58.0 58.0 19.4% 0.0% 0.0% 0.0% 5.21sec 33332766 299.79sec
Messerknecht Messerknecht vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.39sec 0 299.79sec
Messerknecht Messerknecht windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 73.49sec 0 299.79sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health5,475,358.00.00.00%0.0100.0%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Fazed8.849.135.3s5.2s30.3s89.45%89.50%49.1 (49.1)7.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 180.4s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 172.2s
  • uptime_min/max:78.53% / 98.61%

Stack Uptimes

  • fazed_1:89.45%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.849.435.4s5.2s30.5s89.47%89.55%49.4 (49.4)7.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 182.3s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.8s
  • uptime_min/max:80.49% / 98.79%

Stack Uptimes

  • fazed_1:89.47%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.749.535.6s5.2s30.6s89.46%89.53%49.5 (49.5)7.8

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 147.3s
  • trigger_min/max:1.0s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.6s
  • uptime_min/max:80.91% / 98.37%

Stack Uptimes

  • fazed_1:89.46%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.749.335.7s5.2s30.7s89.56%89.59%49.3 (49.3)7.8

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 231.0s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 230.9s
  • uptime_min/max:79.82% / 98.70%

Stack Uptimes

  • fazed_1:89.56%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.778.465.1s3.6s60.3s94.50%94.50%78.4 (78.4)3.7

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 306.7s
  • trigger_min/max:1.0s / 48.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 353.8s
  • uptime_min/max:82.19% / 100.00%

Stack Uptimes

  • find_weakness_1:94.50%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.778.466.0s3.6s60.9s94.74%94.74%78.4 (78.4)3.7

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 306.0s
  • trigger_min/max:1.0s / 44.6s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 303.5s
  • uptime_min/max:82.62% / 100.00%

Stack Uptimes

  • find_weakness_1:94.74%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.381.172.1s3.5s67.3s95.49%95.48%81.1 (81.1)3.3

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 330.7s
  • trigger_min/max:1.0s / 44.9s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 351.0s
  • uptime_min/max:84.40% / 100.00%

Stack Uptimes

  • find_weakness_1:95.49%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.381.071.1s3.5s66.8s95.49%95.46%81.0 (81.0)3.3

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 306.4s
  • trigger_min/max:1.0s / 38.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 320.1s
  • uptime_min/max:80.99% / 100.00%

Stack Uptimes

  • find_weakness_1:95.49%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation3.70.091.0s91.3s11.8s14.68%22.29%0.0 (0.0)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.3s
  • trigger_min/max:90.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.94% / 16.89%

Stack Uptimes

  • flagellation_1:14.68%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.9s14.68%22.25%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.3s
  • trigger_min/max:90.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.82% / 16.94%

Stack Uptimes

  • flagellation_1:14.68%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.68%22.27%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.5s
  • trigger_min/max:90.0s / 98.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.92% / 16.92%

Stack Uptimes

  • flagellation_1:14.68%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.1s91.4s11.8s14.67%22.29%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.4s
  • trigger_min/max:90.0s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.82% / 16.90%

Stack Uptimes

  • flagellation_1:14.67%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1217
Mean 299.79
Minimum 240.00
Maximum 359.97
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Fluffy_Pillow Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1217
Mean 5797933.67
Minimum 5390617.66
Maximum 6241552.84
Spread ( max - min ) 850935.18
Range [ ( max - min ) / 2 * 100% ] 7.34%
Standard Deviation 144351.1574
5th Percentile 5548820.63
95th Percentile 6024226.14
( 95th Percentile - 5th Percentile ) 475405.50
Mean Distribution
Standard Deviation 4137.8523
95.00% Confidence Interval ( 5789823.63 - 5806043.71 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2382
0.1 Scale Factor Error with Delta=300 177878808
0.05 Scale Factor Error with Delta=300 711515230
0.01 Scale Factor Error with Delta=300 17787880750
HPS
Fluffy_Pillow Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health014434490390
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.